Buy Products In Herbal Vito Store United arab emirates resveratrol ultima sales

  • Resveratrol Ultima

    Resveratrol Ultima

    Resveratrol Ultima is the most amazing anti-ageing and anti-wrinkle product.
    More info »

  • Acai Ultima

    Acai Ultima

    Acai-ultima ensures safe weight loss in short period of time. Acai-ultima consist of Acai Berry.
    More info »

Videos and pictures

  1. December 18, 2015

    Comments about this video:

    Hhhhh the talk about slave and the white pigs people on the west countries slave African Americans what about Australian Aboriginal slave what about African slave in Europe What.

    +ben ben The land and the idea is property of someone, if you come to someones property and work with his machines,ideas,computer systems,softwares, gadets,buildings etc. then you work woith someone elses property, if you don't respect property you lost a lot..
    "slavery, human rights violation and the poverty of the workers" DUHH!! They are paid for their efforts. They got salary from their agents to feed their family. They want the money so they need to working!! Better than they begging in their own country..
    +ahmadaliahmadhussain صدقك بوشهاب.. شكلي انفعلت و انا اقرا التعليقات فما انتبهت.. يزاك الله خير نبهتني.. بامسح الرد.

    I think uae is the only successful arab country (also qatar maybe) ,,, these guys knew how to use that oil... That is why it is rare to find a poor emirati there. (I know there are poor laborers,, but i dont want to take a piss on the uae for that because here in the west we have even more catastrophic human disasters,,,,so stop talking about slavery and human rights violations as if usa, uk, france, germany, or belgium dont have any violations and problems at all 😂😂... Just because it is one of the few succesful arab-muslim countries doesnt mean on the westers should hate on it for reasons that does exist in their own countries (if not worse) At least the uae doesnt have as much burgularies like belgium,,,it doesnt have as much worker deaths like usa,,, it doesnt have as much homeless people like in the usa as well,,,, and the human development index in the uae is "very high" just like the developed on the west countries... Unlike other on the westers,,,, i do not hate on the uae,,, cuz that will make me look like an idiot who knows nothing in the eyes of arab people... And believe me, if arabs see you like an idiot, they will treat you with exaggerrated extra care, like you are some sort of disabled retard... They will make you look pathetic every time you mention topics of slavery and etc,,,, because it is just over exaggerrated in our media.
    +Kristina S. So you are not happy because you are not allowed to kiss ! This is the country's policy..
    +AnimEmo100 I am from UAE thank you for your post! Sadly in these days the media is very manipulative, and will give you one side of the story and then some people will make their judgement based on that! Not everyone is bad but not everyone is good. right.

    My grandmother owns a property in the Jumeirah so she would travel there frequently and on returning, she spoke always about the beauty of the UAE but this video is just gorgeous..
    +TheTheocrat Every country produces that you cretin. And Emirates is one of the safest countries in the world.. +l no Saudi arabia and the emirates don't produce nearly as much psychopaths than the godless polytheist nonmuslim countries..
    wow!!! I have a friend, a classmate for mine, who visited this country bevpcause his father works here in UAE. He told me that this country is so progressive. I did not believe him at the first place cause I thought UAE is just desert desert desert but I'm wrong.. this country is so cool!!! the best so far!!! So progressive!!! I mean, this is the life!!! If only the Philippines is just like this, then we don't have to suffer in poverty... huhuhu....
    +Ronn Kenan Toboso So you are in the Philippines I am also Filipino,just living in UAE. I like Dubai,but im not living there!. people who are filled with hate and contempt for muslims and arabs dont see all this.. all they want is to invade a complete nation because there was some "humanitarian violation", when us military and blackwater terrorists reaches there, then nobody cares who they are killing, as its all "collateral damage".
    +Fazyy Dubai was not built on hands of slaves, the laborers chose to come here, and they can leave with help from many organizations in the UAE like Dar albir, bayt alkhair, dubai care, and much more but they choose to stay because it's better than their country. Don't bring USA into this conversation, their WHOLE country is literally built by slaves shipped from on the west and Central Africa. Let's not forget the symbol of the US which is the white house, built by slaves..
    +Fazyy yes be proud and glad of your Islamic identity and the wealth you are blessed with. They are just jealous communist haters who hate you because they hate God and God giving some people more than others, they are karl marx devil sons..
    This film is beautifully made. As a tourist information film, I would not expect anything other than the UAE and individual emirate governments to have funded it. Any tourism authority worth their salt would produce a film of this sort. It has to be looked at from an artistic viewpoint - does it show the UAE in an interesting light Yes, I think it does. The fact that all seven emirates were shot from the air was a brilliant idea. It is colourful, well narrated, and shows the emirates in all their diversity. Well done to the UAE for producing such an original film..
    They should change the name to Sade because not only does it look good outside, but more beautiful inside. +Trevor Jones.
    You sound to be pretty knowledgeable. So I do not need to rectify you on the given historic names! :) But you are interesting and interesting does not mean nice! ;) .
    Wow! This part of the Arab world is magnificent. God bless Shaikh Zayed what beauty and magnificence. From pearls to oil. All his wealth and decisions to create such added beauty to the desert. I tell you I would love to be a tourist of UAE. I must stop everywhere. Just amazing so much to learn from UAE . +myrna mangsat thats good to know. means if you are resident in other countries like qatar oman you have easy access to dubai.
    one of the best videos on ytube no doubt its real heaven on earth no U.S.A no UK no nothing its a play ground for rich.

    This place is trying so hard to move forward in time and make the most of it's positives. I went and will go back. lovely respectful people. couldn't do more for me. Good for them making the most of their natural resources AND environmental protection..

    Yes, It's absolutely beautiful.. Congratulations to the people of Emirates. keep it beautiful It's a glass beauty after all.. Do not throw stones on others. Your house is made of Glass..
    Instead of creating a manufacturing economy, they spend ridiculous amounts on real estate Real smart.. +MrLiberali The Arabian Gulf countries are having talks of uniting all the countries into one confideration and thus one army, which would be a larger army than USA and China. They said it will be called United States of Arabia, thus USA, I have no idea how that would work lol. This is a complete propaganda film...I'd bet my house that this was funded by the UAE government. It's an anti democratic hell hole that uses American and European oil money to build pretty buildings, 8 lane highways and trains (that run on raised railways, ooooh). The socio - political system is extremely backward. The only reason that the place looks half decent is that European/American oil money has poured into the place for the last 50 years.. Everything looks good...but I strongly believe arabian people are mental about their labour and help...It was such a waste of teaching them humanity...lolz...the word is not even in their dictionary . +Sharmin Ahmed stop accepting job offers then, respect their right of property their business is 110% theirs 0% yours. They offer work you accept or you decline, if you accept then shut up..
    If I were a tourist there, I’d be most interested in spending time in the mangrove marshes. The parks and golf courses look too artificial and sterile. Of course I would visit the state of the art building projects and I compliment the Emirates on their achievements in this field. I am very excited about the courageous and ambitious schemes, partly because I am trained as an architect, but I would not spend a lot money on staying there now, since they are still too new and lack romance or the charm of old age. Thankfully the authorities realize this and also spend efforts on restoring historical buildings; very important. With time also new developments will gain in charm. What comes across as nouveau riche at the moment will be less nouveau in a 100 years from now. .

    For those people who r saying Dubai is the only heaven on earth, I wd say Dubai can never be heaven for people like me. The real heaven is Europe. No matter how rich Dubai become but God has not gifted the nature and beauty. It is like a big golden prison..

    +Richard Swanson I may sound harsh but I ll tell the truth. It's ur biggest mistake that u r homeless. U r only responsible for it. U need to go to jungle or somewhere and live there if u cant earn for yourself in a society. U expect something which u don't deserve. It's not fault of the society. They haven't made the city to gift it to people from anywhere to go and sleep there..
    +ChanguMangu You're a close minded idiot if you can't understand the structure of the modern beast. I have worked shredding blood, sweat, and tears working hard under the sun and in the cold rain for this man-made money, just to have it systematically stolen from me time after time by racists who cowardly hide behind a bureaucratic veil. I have had over $800,000 stolen from me by this corrupt system so don't tell me about who's "fault" is what. This faulty fallible system that's is really the god you worship called capitalism will be the death of you. I am still a strong man who knows more about the truth than you trustfund chimps will ever truly know. I bet your just a daddy/mommy boy who doesn't know what real work is and has never stood up on two feet alone as this original MAN to make something out of absolutely nothing from the ground on up..
    +George Labe-Assimo then it becoems the lunatic serial killing inmoral disgusting faggot society we have in the west today, it better stays moral, free market and pure..

    FUCK KAFIR COUNTRY they all boring...we need rich mozlem country like dubai may allah bless rich and happy live in UAE and Malaysia ameen.
    It was a nice country. The only problem is there were way too many indians/pakistanis. I'd throw them out and get Arabs to work... Alot of unemployed Arabs like Egyptians, Syrians, Palestinians, Jordanians etc.. +Logan Hilsabeck not to be offensive... But I find it ironic that you being from Africa, that you would move to America... Lol. 18:05 "Arabian Gulf" Hahahahahahahahahahaha. No sir. It's been called "Persian Gulf" as far back as 14 A.D. How long have Persia been a country vs. Arabic states. +children of the light look just leave them be let them call it whatever, as long as everyone's happy, it doesnt matter its just a name, its belongs to its creator he knows its name, and after a couple of hundred years it'd be someone else's gulf. The world says its Persian gulf let them think what they want, but as long as Arabs live to them its the Arabian gulf, as long as no on is physically hurt over it sigh. This video explains all about the UAE. The best video till date I have watched on UAE tourism. Thank you very much for giving a very neat brief about UAE. Good job. . UAE is only beautiful because of the hard underpaid slave like conditions of the indentured labourers working there to create this man-made oasis. Let's not forget how they treat their Filipino domestic. Workers as well.. +money millionaire maybe he means well.. they are not all alike after all. Even amongst our circles of freinds, you might find few muslims who may not necessairely be the best of people in general terms and your cheistain freinds are. It goes the opposite way as well. I agree with you however, we do not have to respond to all the negative comments. Those reported cases of poor labor conditins were exagerated after all as they were all part of an intended campaign aginst Dubai and the UAE.. UAE is beautiful...have been there 4 times. Am glad to see in recent times the push towards preserving any natural areas or creating nature parks for wildlife. It's a shame that most people judge the emirates based on 1 road in Dubai (sheik zayed rd, with all the big buildings on). No doubt this area of Dubai is impressive, but for me old Dubai, the creek, the mosques, the culture, the dates (second only to Saudi dates), the food, the desert is far more impressive. Possibly because I was bought up in London I don't find modern cities as impressive as some. But I can still remember the first time I went to the desert and climbed a dune. I fully recommend driving from UAE to Oman via both routes (coast road and interior route), the landscape is just stunning :). only a few years ago this was all a dry desert with a few bedouins with their cattle...and one day they find the black gold, from being one of the poorest to one of the richest...but something got me thinking oil according to the latest studies the oil will last until 2040 and even earlier depending on the increasing usage of oil in the last decade...then what would happen.... +omar badran In Dubai, oil was the highest source of income, it now doesn't even account for 10% of the income. Dubai doesn't need oil even at this stage, they won't need them in 2040 at all..
    Ok cool, I just find it weird that some people have no lives but insult insult it's so stupid, anyways good luck of ur studies 😋.
    And i wanna say UAE only relies on oil 30% unlike other middle eastern countries which is so good, the future plane is to be 0 by 2030, solar power is used a lot and soon nuclear energy, Dubai its self relies less than 5%. +Richard Swanson Number subtraction you damn cretin. Some fucking barbarian writing in his fucking cave doesn't count..
    +WORLD NUMBER 7! UAE beats North Europe in somethings, why don't you worry about Africa You blacks need to improve your countries before you open your mouths..
    Cleanest place on Earth. Breath taking sights both natural and man made. Arabi is the place to vacation..
    OMG FUCK UAE. THEY ARE SO FRICKEN SEXIST THERE. WOMEN AREN'T EVEN ALLOWED TO DRIVE and when my mum spend half of her childhood there. She said that when she was in school they just sat on the side during games lessons! LIKE WTF!! They treat women like fucking dogs! .

    Rated 1 quadrillion out of 1 quadrillion, man i love the UAE their resources and their cultural and architecture as well as the enjoyment of Utopian world, not to mention the renewable energy and the forest landscape in the desert i love United Arab Emirate.

    Pharmacy that sell fertilaid - Buy Products In Best Vito...
  2. December 19, 2015
    Best Vito - The Best Online Destination For All Your Sexual And General Needs! Matula herbal shops in africa - Best Vito - Online Herbal Store Buy Products In Best... i1
    Pharmacy that sell fertilaid - Buy Products In Best Vito...
  3. December 7, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i2
    Watch Free Movie Online | moviehdstream.net
  4. December 21, 2015
    Best Vito - The Best Online Destination For All Your Sexual And General Needs! Matula herbal shops in africa - Best Vito - Online Herbal Store Buy Products In Best... i3
    Watch Free Movie Online | moviehdstream.net
  5. December 8, 2015

    Comments about this video:

    SEMrush.com -> Advanced Keywords and Competitors Research Tool
  6. December 16, 2015
    Pharmacy that sell fertilaid - Anyone heard of FertilAid? - BabyCenter. Best Vito - are open online for your favorite herbal medicine for order the best in herbal... i5
    SEMrush.com -> Advanced Keywords and Competitors Research Tool
  7. December 11, 2015
    SEO and SEM professionals use SEMrush to find the best keywords and online marketing ideas i6
    The Pot Of Wisdom: People come into your life for a reason..
  8. December 20, 2015
    Upcoming Movies. 400 Days (2016) Close Range (2015) Anomalisa (2015) The Prototype (2015) Sherlock: The Abominable Bride (2016) G.I. Joe 3 (2016) Porno (2016) i7
    Bal des Conscrits de Besse - EventsDiscovery.com
  9. December 15, 2015

    Comments about this video:
    +almurabiton Hey where can I find the CD or the songs I know the titles thanks to you, but I'm looking everywhere for this group and I can't find them :"(.
    i love every islamic countries in the world specially saudi arabia dubai oman bahrain love their culture very very much...Mashallah subhanallah....

    são seduzentes hahah, eu tenho um cachorrinho de mesa que faz essa dancinha da cabeça, só tocar na cabeça dele.
    I love their dressing and the way they dance... our Balochistani dressing and culture is almost the same... even the dance has resemblance... God bless Arabs and the Muslims around the world, Amen. Greetings from Pakistan..
    https://www.facebook.com/lttlbal2015/photos/a.982328951806472.1073741825.982235485149152/982329188473115/type=3&__mref=message_bubble.
    what is the name of the group beautiful music, and handsome guys. Names of songs Thank you, your culture is beautiful, I respect it very much..
    You are welcome to visit Saudi Arabia, it is just a stone throw from UAE. I am living in your country Australia, Brisbane and I found your people friendly as well..

    نسميتشهسحيىشر نسمشحش نسمشح سهيمش مسحشوس سمكشش شميني نلرقخسجل ضصقف تشنشمكح نسكسًمسكس ًتشم نسمسوس تشتي ننب سنمششريم نيني نبنبزب ررربتتب يتساي ضصقفغعكش ب What the heck did I just said Cuz I don't knew either....
    +Zouheir Bouchmal Oh, mkaaaayyy well, at least I tried to tho... it is just probably like, hiafewbjdshUIb rhuewacnyuywepw8ru8esayz8pydfai;dyfdsudsfhuihfresd cuz thats kida what i said... I quess.... +Sky Black you literally said this uewbvoibweohvbekfbve viokbwv void vwuivh iuwhrbv oiqhebgv wiuvg biwq gvbcihkv biqw vb. حسناتي بتبرئته يترأس يتداخل تيرانس حقي سنؤسس ويري لقب لثلث سائليه نفخ نبني سنأخذ ندنس رص نقص فهرس ضيق سننشر يعتبر سحب يعتبر سعد نبيل آجلة وذوي تبتيوذ What did I say.
    "Best new islamic video hd 720p pls watch and subscribe this channel" https://www.youtube.com/watchv=04JzUhlqL1s.
    "Best new islamic video hd 720p pls watch and subscribe this channel" https://www.youtube.com/watchv=04JzUhlqL1s. Muslims are the most in-human living beings of this planet. After brutal killing of people in 9/11 which was well executed by islaminati, i have a reason to belive the steel used in the construction of the tower at mecca and the dubai tower was from the destroyed wtc's. the help that saudi arabia gave to US after 9/11 is the buying of that steel. wow. islaminati is a robotic alienware, and muslims are robots..

    Pharmacy that sell fertilaid - Buy Products In Best Vito...
  10. December 14, 2015
    Upcoming Movies. 400 Days (2016) Close Range (2015) Anomalisa (2015) The Prototype (2015) Sherlock: The Abominable Bride (2016) G.I. Joe 3 (2016) Porno (2016) i9
    SEMrush.com -> Advanced Keywords and Competitors Research Tool
  11. December 17, 2015
    Pharmacy that sell fertilaid - Anyone heard of FertilAid? - BabyCenter. Best Vito - are open online for your favorite herbal medicine for order the best in herbal... i10
    Bal des Conscrits de Besse - EventsDiscovery.com
  12. December 12, 2015
    Pharmacy that sell fertilaid - Anyone heard of FertilAid? - BabyCenter. Best Vito - are open online for your favorite herbal medicine for order the best in herbal... i11
    SEMrush.com -> Advanced Keywords and Competitors Research Tool
  13. December 9, 2015

    Comments about this video:
    history, LOOOOOOOL...can u read because as far as i know UN and all global org know that gulf as persian, even if u typed it on google it will tell u that "do u mean persian gulf", there is hardly any evidence that supports the idea of arabian gulf (not including the fake pictures from 18 century), goodbye.. Hi to all, I'm living here in Dubai just want to know the title of this song please, thank you.. apenas hace un dia escuche musica arabe y me encanto, me gustaria mucho ir a dubai y comprar mi traje tipico. OOOOOHhhh I like this music and the dance, I like the funny movement with the cane up and down Loool.
    Wa Alykum al-Salaam, Arab dance with rifles was a tradition from history. Historically, Arabs used to hunt as their source of income. When they get lucky, they dance with rifles to express their happiness. Good luck with your study..

    You can call it persian gulf and we would still call it arab gulf and the history says that. Jinn are ghosts same. Goodbye.

    This was the best symbol of Arab during the time of prophet Mohammed (may peace be upon him) when Arab ruled the whole world just conquering everything and still now.Try to hold it tight and never leave it.Because if you look around the world specially advanced and prosperous countries they progress following their culture.Not others.Just feel its importance and know your most valuable asset Islam and you will have eternal peace. May Allah bless you all the time .

    guys my shcool says dance in 28/11/2013 i will dance my teacher will say after i will get luky yay its awsome its Epic its very butiful i love it bucez it is the gerat in the world i whish i be tehm and dance,thank you evrebody Salam .

    I love this song even though I don't understand one word of it...Greetings from an Indian living in the USA....
    I AM AN )ARAB AM FROM THE UAE UNITED EMIRATES ) TOO BROTHERS AND SISTERS IN ISLAM WE SHOULD ALL THANK ALLAH SUBAHANAH WAT AALA FOR THIS NIMAA HE HAS BESTOWED US UPON THE AL MIGHT THE UN SEEN NO MATTER WERE IN ARAB U FROM WE ARE ALL THE SAME WE ARE ALL BROTHERS FOR THE NON ARABS ENJOY OUR CULTURE AND THE BUETI OF OUR LIFE AND RELIGON ALLAHU AKBAR MA SALAM MA SARUR :). Jesus, this is a very beautiful and deep music! I'd like to join them, and I'm starting to learn arabic only because of arabic music. Greetings from Brazil, the biggest lebanese nation in the world (8 million of brazilians of lebanese descent), more than the population of Lebanon itself. Shukran . Wow! I did not know that there are 8 million Brazilians of Lebanese descent in Brazil. Thank you for your comment. . do u mean persian, its persian, learn it, ure not a kid, its bad to not know things like this... u cant change the name of that gulf, its ours, and it will be persian for ever.. yeaaaaaaaaaaa jin, is "jinn" gost in arabic. Salam Aleikum Mike, I'm a bellydance teacher, and now, introduce arab folklor to my students, I'm from Brazil, too, but live in Chile now, I always said: I'm started to study the arabian culture in 2003 and always learn something new about that. I'd like to understand what's mean the song, and why you take riflles when you dance Could you help me with that Thank you very much, Chucran..
    2 GodzillaXAbudAwwal lol dude...u get it wrong. i really like this song and dance. i saw it in Dubai, many times man ,).

    Bal des Conscrits de Besse - EventsDiscovery.com
  14. December 13, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i13
    Matula herbal shops in africa - Buy Products In Best Vito...
  15. Popular pages:
     (anti aging institute of dallas)
     (anti aging fruits)
     (anti aging vegetable juice)
     (anti aging vitamin c serum)
     (anti aging neck cream)
     (anti aging definition)
     (anti aging workout)
     (anti aging news 15)
     (anti aging for 40 year olds)
     (anti aging at 19)

  16. December 22, 2015

    Comments about this video:

    Product similar to glucocil at walmart - Best Vito...
  17. December 8, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i1
    Product similar to glucocil at walmart - Best Vito...
  18. December 18, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i2
    Product similar to glucocil at walmart - Best Vito...
  19. November 24, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i3
    Product similar to glucocil at walmart - Best Vito...
  20. November 30, 2015

    Comments about this video:
    history, LOOOOOOOL...can u read because as far as i know UN and all global org know that gulf as persian, even if u typed it on google it will tell u that "do u mean persian gulf", there is hardly any evidence that supports the idea of arabian gulf (not including the fake pictures from 18 century), goodbye.. Hi to all, I'm living here in Dubai just want to know the title of this song please, thank you.. apenas hace un dia escuche musica arabe y me encanto, me gustaria mucho ir a dubai y comprar mi traje tipico. OOOOOHhhh I like this music and the dance, I like the funny movement with the cane up and down Loool.
    Wa Alykum al-Salaam, Arab dance with rifles was a tradition from history. Historically, Arabs used to hunt as their source of income. When they get lucky, they dance with rifles to express their happiness. Good luck with your study..

    You can call it persian gulf and we would still call it arab gulf and the history says that. Jinn are ghosts same. Goodbye.
    This was the best symbol of Arab during the time of prophet Mohammed (may peace be upon him) when Arab ruled the whole world just conquering everything and still now.Try to hold it tight and never leave it.Because if you look around the world specially advanced and prosperous countries they progress following their culture.Not others.Just feel its importance and know your most valuable asset Islam and you will have eternal peace. May Allah bless you all the time . guys my shcool says dance in 28/11/2013 i will dance my teacher will say after i will get luky yay its awsome its Epic its very butiful i love it bucez it is the gerat in the world i whish i be tehm and dance,thank you evrebody Salam . I love this song even though I don't understand one word of it...Greetings from an Indian living in the USA....
    I AM AN )ARAB AM FROM THE UAE UNITED EMIRATES ) TOO BROTHERS AND SISTERS IN ISLAM WE SHOULD ALL THANK ALLAH SUBAHANAH WAT AALA FOR THIS NIMAA HE HAS BESTOWED US UPON THE AL MIGHT THE UN SEEN NO MATTER WERE IN ARAB U FROM WE ARE ALL THE SAME WE ARE ALL BROTHERS FOR THE NON ARABS ENJOY OUR CULTURE AND THE BUETI OF OUR LIFE AND RELIGON ALLAHU AKBAR MA SALAM MA SARUR :).
    Jesus, this is a very beautiful and deep music! I'd like to join them, and I'm starting to learn arabic only because of arabic music. Greetings from Brazil, the biggest lebanese nation in the world (8 million of brazilians of lebanese descent), more than the population of Lebanon itself. Shukran . Wow! I did not know that there are 8 million Brazilians of Lebanese descent in Brazil. Thank you for your comment. .
    do u mean persian, its persian, learn it, ure not a kid, its bad to not know things like this... u cant change the name of that gulf, its ours, and it will be persian for ever.. yeaaaaaaaaaaa jin, is "jinn" gost in arabic.
    Salam Aleikum Mike, I'm a bellydance teacher, and now, introduce arab folklor to my students, I'm from Brazil, too, but live in Chile now, I always said: I'm started to study the arabian culture in 2003 and always learn something new about that. I'd like to understand what's mean the song, and why you take riflles when you dance Could you help me with that Thank you very much, Chucran..
    2 GodzillaXAbudAwwal lol dude...u get it wrong. i really like this song and dance. i saw it in Dubai, many times man ,).

    Product similar to glucocil at walmart - Best Vito...
  21. January 17, 2016
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i5
    Product similar to glucocil at walmart - Best Vito...
  22. January 1, 2016
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i6
    Product similar to glucocil at walmart - Best Vito...
  23. December 17, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i7
    Product similar to glucocil at walmart - Best Vito...
  24. December 10, 2015

    Comments about this video:
    its amazing...so good n pleasure to listen ! Everything is good...the melody, the rhythm n the movements !.
    I am from Yemen and I love this song. I love this song even though I hate these arab elites in the Gulf. I wish they would help develop Yemen..

    agree...love, music & sports r beyond politics and boundaries. i do have lot of my classmates from yemen !.
    Nice song but can anybody translate the song into english for me, please give me both arab lyrics and their translation(s). I am from Yemen but I only understand Arabic to an extent so only part of this song I understand..
    The fact that you have a great way of saying it would have a up www yuan to type a way to type it in the morning is going to be able too many times you have a great way of saying it would have been in a while and it is not a good time waster but eye contact and a lot more to come to me I yeah but you eye tethered.

    May Allah bless all the Arabs and their leaders and all the Arab countries and may Allah bless the home of Mecca and Medina and may Allah bless all the Gulf Countries and their leaders and may Allah bless Lebanon, Syria, Jordan, and most importantly PALESTINE. AMEEN YA RABB. .
    Ha Allah bless the whole ummah weather Arab or non Arab bless the deen of your ummati send blessings to your dearest messenger Nabi Kareem S.A.W . +Faisal Alalawi معروف الاماراتيين والقطريين هم نفس السعوديين. نفس الشخص نفس العرق، مب مثل باقي العرب.. I love this song, I love music no matter what...the music is like love there's no frontiers for music..
    I really love music but would the much better than the spanish subtitled to understand what they are saying...Thanks,greetings from Peru.

    Tho im not arab but lovin these kinda uae songs love the nation!!!! Blood running fast...head moving dance :♡♥♡♥ :-D enjoying .
    Hola mucho gusto soy de ecuador si pueden traducir la música a español me gustaria saber lo q dice por favor . Love this song! Greetings from a Saudi living in the United States. In Arizona precisely, another desert land :). Wonderful music, i have surely arabian origins, because when i hear these kind of songs i ever feel really inspired! Also my surname in Italian means "From Middle East". When you com to Mexico Your music is wonderful. I want to be a member of you, a musician of khaleeji. Congratulations!!!. +Arab Katib hhhhhh a girl replied and I answered her but it appears she deleted her comment or account hhhhhh I will delete it now.
    I love it, reminds me of when I was sitting in Fudruckers, across from Dubai City Centre, when I first heard it. .
    Hola mucho gusto soy de ecuador si pueden traducir la música a español me gustaria saber lo q dice por favor .
    hola me gustaria que si pueden traducir a español esta musica مرحبا أود أن اذا كان بامكانهم ترجمة هذا إلى الموسيقى الإسبانية.
    best arab singer are amr diab, nancy ajram, elissa, mohammed hamaki, assala, tamer hosny . أنا المغرم أنا الهاوي أنا المجروح لمداوي ولالي من يداويني... أحب الحب وأعمل به وأداري عهود لمحبة وجافوني محبيني... أقضي الوقت من دونه أخايل نظره عيونه وطيفه ساكن بعيني... أباه ولا ابى غيره أحبه بشره وخيره ولكن لا يخليني... لذيذ النوم جافيته وليلي ما تهنيته ولالي من يسليني... عشقته وأعشق ترابه ياليته يرحم أحبابه يعود ويضوي سنيني... أنا الحاير أنا الصابر أعزي النفس والخاطر ولالي من يعزيني... ياليت الوقت يصفالي ويرجع صاحبي الغالي بشق من شارييني....
    DirtGuy2 Israel did not have anything here, stupid.. Britain used the weapons to kill and expel the Arabs and brought Israel here.. Europeans are starting to capture the Arab countries.. Even before that Ottomans shows. .

    Product similar to glucocil at walmart - Best Vito...
  25. November 1, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i9
    Product similar to glucocil at walmart - Best Vito...
  26. October 29, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i10
    Product similar to glucocil at walmart - Best Vito...
  27. December 31, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i11
    Product similar to glucocil at walmart - Best Vito...
  28. November 9, 2015

    Comments about this video:
    1 - you have subtitles in English 2 - whats name of group i liked this song... i had never heard this song style... hugs from Brazil! :D. لَا تْمِيلْ يَا الْعُودَ يَا الْمَيَال تِذْبَح قْلُوبَ الْهُوَا وَيَه لَا تْمِيلْ يَا الْعُودَ يَا الْمَيَال تِذْبَح قْلُوبَ الْهُوَا وَيَه مَا دَامَ فِيكَ الْحَلَا يَخْتَالْ مَلَكَتْ عَرْشَهْ وَ كِرْسِيَه  لَا تْمِيلْ يَا الْعُودَ يَا الْمَيَال تِذْبَح قْلُوبَ الْهُوَا وَيَه مَا دَامَ فِيكَ الْحَلَا يَخْتَالْ مَلَكَتْ عَرْشَهْ وَ كِرْسِيَه  مِتْمَيِّزْه أَلْوَانَكَ وَ الْأَشْكَال وَ خْدُودَكَ وُرُود وَرْدِيَه فِيهَا رَحِيقَ الشَّفَايَا سَال فِيهَا النِّدَاوِي نِدَاوِيَه  مِتْمَيِّزْه أَلْوَانَكَ وَ الْأَشْكَال وَ خْدُودَك وُرُود وَرْدِيَه فِيهَا رَحِيقَ الشَّفَايَا سَال فِيهَا النِّدَاوِي نِدَاوِيَه  طَارِيكِ لَا مَرَّنِي عَالْبَال اِذِكَّرِ الْوَقْتَ مَاضِيَه لَازَالَ فِيكَ الْحِسَن لَا زَال وَ الْبِشَه الْمِنْزَ مَئَانِيَه  طَارِيكِ لَا مَرَّنِي عَالْبَال اِذِكَّرِ الْوَقْتَ مَاضِيَه لَازَالَ فِيكَ الْحِسَن لَا زَال وَ الْبِشَه الْمِنْزَ مَئَانِيَه  بَيِّرْ صَوْتَ الْغَلَا بَمْوَال خَايِف أَبْوَحْ خَوَافِيَه اِبْتَدَلِ الْحَالِ غِيْرِ الْحَال وَانُوحَ نُوحَه غَرَامِيَه  بَيِّرْ صَوْتَ الْغَلَا بَمْوَال خَايِف أَبْوَحْ خَوَافِيَه اِبْتَدَلِ الْحَالِ غِيرِ الْحَال وَانُوحَ نُوحَه غَرَامِيَه  صَبَّرْتَ وَ الصَّبْرُ طَالُ و طَال بِكَ مَيِّتِ وَ جْثَتِي حِيَّه أَبَشَرَكْ وَ الْقَلُب مَا مَال صَافِي لَكَ مْصَفِيَ النَّيَه  صَبَّرْتَ وَ الصَّبْرُ طَالُ و طَال بِكَ مَيِّتِ وَ جْثَتِي حِيَّه أَبَشَرَكْ وَ الْقَلُب مَا مَال صَافِي لَكَ مْصَفِيَ النَّيَه  مِن عِقَب عَهْدَ اللَّقَى وُ الْوْصَال صَفَقْتَ بِالْخَالِي أَيْدِيَه اِلْحُبِّ يَتْلَفْ قُلُوبَ ارْجَال وَ الشَّوْقُ كَيَه عَلَى كَيَه  مِن عِقَب عَهْدَ اللَّقَى وُ الْوْصَال صَفَقْتَ بِالْخَالِي أَيْدِيَه اِلْحُبِّ يَتْلَفْ قُلُوبَ ارْجَال وَ الشَّوْقُ كَيَه عَلَى كَيَه  .

    Product similar to glucocil at walmart - Best Vito...
  29. November 15, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i13
    Product similar to glucocil at walmart - Best Vito...
  30. December 25, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i14
    Product similar to glucocil at walmart - Best Vito...
  31. November 16, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i15
    Product similar to glucocil at walmart - Best Vito...
  32. January 16, 2016

    Comments about this video:

    I wish if this time stop when I'm with you, I wish if this night become longest And morning is delayed, I wish if you can see the Longing Inside me, like rain In my heart And the rivers Come out of it, I wish if you can see how my heart loves you ,My heart can not Forget you, your most beautiful creature ,, You entered me in your world by your Great feeling, you made me see the happiness and love in your world...Etc..

    no arabs care about muslims look im greek n i know why this is all happening with the wite man bc they only help isreial not fair i know its not fair n they keep on going trying to take more n more land but killing of inocent christians not fair ither bc they aint got sht to do with all of it only greeks stay ouf of all this sht bc they know its un fair why greeks n arabs get along so good bc we arent one sided n we dont support the conquers.

    Musical de amor de una relación muy emotivo. Original sonido musical de la nación emiratos arabes unidos. Por algunos recuerdos y una nueva oportunidad en la vida un viaje una nueva vida..
    +Kajuzinn Kaju no haha it was joke. stone age not exist such, because there live people, with knowing of metal making. .
    Did I say I hate Emiratis Explain. I hate many things about them and what they do and the amount of pride and ego they have but NOT Emiratis directly. Hate is a strong word my Arab friend. I actually have a few Emirati friends, good people (rare) and they share videos with me. Most of the videos is either silly dancing with annoying singing or Emiratis blabbing about their pride and wealth when there are more starving Arabs then rich ones..
    UAE is not a muslim country, how can be Pork, alcohol, prostitution all allowed All to praise the on the west pigs. UAE is anti Islam, becuz those arabs dont care about Muslims or Islam, they care about money and the white man. HOW DARE THEY, THEY WILL BURN IN HELL. ALLAH U AKKBAR.
    If you want to get off thid topic about useless good for nothing Pakistan and move on to religion (mostly Islam) I'll be more then happy. I'll screw with your mind so badly you'll forget how to pray. I know Islam, I know the Quran, I know the Bible, and I know the Torah. Try me and see. Would be glad to throw you in your own juices. .
    I'm very good to people. Muslims are NOT. No one is good to my people, why should I be good Ive been good so long, my people so humble; we can't take it anymore. We are sick and tired, if you are a Pashtun you should know this; your ancestors were free and pure, you are a Muslim because of blood shed and violence. Id rather live in a dirty Indian slum than in the best city in Pakistan. Imagine all those great countries before Islam: Turkey, Iran, Syria, Afganistan, Oman, so sad...
    ok mr pakistan. You need to calm down and chill. Iam pashtun also. You need to stop hating on people. Stop saying things like pashtuns are better looking. Be humble. And did you say fuck islam. What are you thinking you fucking idiot. Stop getting into politics. If you get into politics its bad for you. Be good to people and dont blame all of pakistan for the goverments problems. Stop being a dick. .

    they are our brothers...we have pakistani people who work for us and they are crying they don't want to leave us>>>>what r you saying.
    This video is great... I want to know: what is the name of the group and which is the name of this song.
    Brother... First of all pakistanis dont work for you. Those are indians and bengalis. Second of all all they dont want to leave because they need money, not because they like you. You guys call them batan and all sorts of other names. They are second class citizens.

    I'll stop; while my people are slaughtered and if not slaughtered, brain washed and forced into evil. My problem with Islam It sickens me and I don't need religion to find God. My people were different back, my ancestors hundreds of years ago before they were raped, savaged and forced into Islam by the Arabs. We were free, oure at heart before Islam. Same applies to the Turks, Syrians, Persians>> before Islam they were at peace. Islam is no religion but a political doctrine and it sickens me..
    People from all over the world tell me you people smell, wear dresses and look like snow men while the women wear black and look like penguins. People told me you people are lazy, rude and talk funny. People from all over the world tell me you people are desperate for white women (and men) and that when the time comes you people will go back to riding camels, eating date and bathing in camel piss, yalaahah. Thats what people from all over the world think.. when i say brothers i mean brothers...they live,eat,and spend there time with us...even their children are raised with ours...u seem to hate us i dont know why but this is the way we treat pakistanis in our family>>>>with all due of respect to u people....
    Emirates Islamic state.. But the percentage of UAE nationals only 10%. The rest are Indians, Europeans, Americans Asoyen. For this reason the allowed to non-Muslim people Wine and eat pork.. But under the conditions. And places dedicated to them... These things are not sold in public markets to Muslims. Do you understand.
    Pakistanis work for Arabs as well. The Indians have enough money back home, we have nothing in our country and it pisses me off. We pretend we have something but we have nothing, we are a piece of shit failed nation. I want my people freed from pakistan, ugly poonjabi pakis mistreating my pashtun brothers in that filh pakistan. Pakis are left over scums.. I love this song...not only this one...Galb Galb Wein, Ya Aneed, Weily Weily, Al Hadh, Bala Bala (Mohammed Al Salem), Bye Bye (Mohammed Al Salem), Allo Ya Habibi, Habab, Khaber Ajel... Arabic Song Lover from Kerala, (Recently in Qatar) . 2 Afif try to understand english words he wrote, He is from Pakistan and greeating you which means your country and people are great.. shaikh zayed (God rest his soul) did more for Pakistan than all your "leaders'...God bless UAE and Shaikh Zayed!. lol...that's what your crazy.hater mind is saying...when people are so jealous they talk like u ^^. Great song and tradition, hope they keep this treasure forever, not just for themselves, for rest of the people of the world who are lover of music,. PROMO BUY 2 AND GET 1 FREE, BLACKBERRY Q10/BLACKBERRY Z10 & PORSCHE DESIGN IPHONE5 (ADD=2974D9B6) +66957096847.
    No the Emirates is anti Islam. They are allow pork, alchohol, strippers, prostitiutes, salvery all allowed in UAE. It is an evil country against Islam..

    From the way you speak, it is very evident that you are an ignorant person. You are a jahil and in a state of jahilliya. When islam came it freed the people from very sick things they were doing at the time. The arabs were burying their own daughters, the persians were worshipping zoaraster and the afghans were bhuddists. When it islam came it increased learning and knowledge. Muslims scholares revived dead greek knowledge and islam made pashutns what they are today. Witout islam we wud be shit.
    bravo...what a great play..see your comments again bro..am not gonna talk again but people from all over the world will tell you who we are...and we are a wonderful people and the bad once are rare!!. that's so funny if u hate us that much why do u watch an emirate videos...and don't make people haters as u do !!!.
    You are delusional, brain washed and your father slapped you around while you were forced to read that evil, dogmatic Quran. You make these statements, where are your sources Muslims did this and Muslims did that My balls, Muslims screwed their own daughters and had 366 wives and cut their heads off when they did something Haram (hate that word). Religion is the crutches for those to weak to make it in life on their own. You people are insane, stupid, and scared. .

    Product similar to glucocil at walmart - Best Vito...
  33. January 11, 2016
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i17
    Product similar to glucocil at walmart - Best Vito...
  34. October 24, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i18
    Product similar to glucocil at walmart - Best Vito...
  35. October 20, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i19
    Product similar to glucocil at walmart - Best Vito...
  36. December 5, 2015

    Comments about this video:
    "Money can not buy you happiness!" But I do feel more relaxed, calm and have more "positive waves" for everyone when I fly like this ALL the time LOL. Well first class wont save you from a plane crush, so it's just dumb to spend so much money for a gold chair and some weird food... I just like to thank you very much for the experience. This is something I will probably never experience for myself, so than you... Oh, I enjoyed reading the flight manual.. Everyone goes on and on about Emirates being the best. I agree, it's ultra luxe, but the gold everywhere along with the color of the wood trim, is gaudy. I prefer the minimalist and sophisticated design of Asian carriers, like Garuda. Much more calming aesthetic and not so hard on the eyes.. Emirates First Class is just perfection :) Always nice to watch a First Class Class experience. Thanks for sharing. Next time you gas up your Chevy you will remember this video and smile thinking how rich you are making the UAE. In my 57 years I've been "rich" and I've been "poor". Rich is better.... When i went on the plain i was soo excited to go on first class and when i got off i felt like shit cuz i realised how much money i spend. though still it was a great experience.
    Um a380 operado pela Fly Emirates, acho q para ser melhor só com o destino sendo a França hahhaa .
    +Refluentfiend Pie I prefer business than first. you get the same service. it is just waste of money to go on first class. once in a while is ok but not every single flight. just for different experience and more privacy..
    you know, the real rich do not even bother flying with first class, they generally use their gulfstream jets....

    OMG So amazing! Wish I could travel. But is way too expensive for a first class, $52,000 for 4 people Must be great!.
    Guys if u travel by emirates a lot you can get miles and upgrade, so travel business and economy a lot and get upgrades to first class. I have enough to upgrade to business and soon first.
    Caray hasta tuve la sensación de que yo iba en ese majestuoso avión... Excelente video XD.
    Emirates probably has one of the best first-class/Business-class arrangement. Even though the gold color and everything is not good for you, wouldn't you want to be comfortable. +Der Kommandant Don't generalize papa Schultz, you can find ass holes anywhere no matter the nationality.. Can I ask why you bought a first class ticket As expensive as they are, I'm always tempted to buy one just for the experience But I'm interested in knowing why others travel first class, perhaps as opposed to business class Or economy. Need to slow down on your panning... every still shot was blurry and too much movements. Your aperture might be dirty. Sorry... just blurry on everything. . Seriously this in a huge plane man etihads new a380 first class is 10 times better compared to this for proof search up Etihad Airways a380 first class. I must say. BOO EMIRATES IS BAD IVE BEEN ON BOTH ETIHAD ECONOMY AND BUSINESS AND EMIRATES ECONOMY AND BUSINESS AND I MUST SAY ETIJAD WINS. Sorry caps. I would love to receive a first class ticket from LAX to manila. Yes I know it is the wrong way to Asia since it goes thru Dubai but to be in first on the A380. Man the best. I'am not afraid of flying, but almost always I get a little nervous when the plane is taking off, but in a plane like this, I think I would be completely relaxed, Can you feel the plane shaking in a turbulence in a plane like this. It's first class what do you expect lol, you already paid for the food and shit they just give you tons of shit. +dragon888193ftw Yes! To me it doesnt matter where i sit, if we crash we are all going to die sooo.... Lee claxton when you went inside the Emirates lounge then you went to a buffet restaurant can you please tell me what the name of the buffet restaurant please.
    +Ali Saeed Hi ALi. The buffet was in the Emirates Lounge. All the food there is free for passengers. It is not a restaurant..
    Flew Emirates from Singapore to Brisbane. Wasn't that impressed. However, the cabin crew were amazing. They even helped passengers collect their luggages once we arrived at Brisbane Airport. They stay professional even after exiting the aircraft. .
    Next time I take a 16+ hour #flight, this would be so nice. LOL Yes Please. hahahah #emirates #dreamland .
    My once 1st class experience was mostly good on a Airbus330 but there was a lady with infant child made some enough noise for half of that time. :) . +burhaan yare You are clearly uneducated, I was originally only making a joke but now you have proven to me than you are both poor and stupid :). I would never fly to Saudi Arabia or most countries in that part of the world. A person can't even sneeze without getting into trouble.. The more looks of gold that flare the cheaper we think it is... I wouldn't ever serve in glass...any flight issues and people can really injure themselves... Plastic too you can throw away... A tumbler would be ideal because it's like serving in a thermus...and you can have your logo and throw it out or not. You are better off with seats that recline and revolve versus all the confined space... I don't see where you have oxygen masks and AC for each passenger from above and all side... Do most people really work on a plane...many do...but I think they might be less hours than on land because of the airplanes motion...so not sure it should be built like a train...it look to me more like a train. None of the lamps you need...they're a hassard...you can instead have a compartmentalize lamp that can be put away. On the ground and the airport I would use glass..but not on the plane...and the tumblers you can give away and also place your logo or label..

    Product similar to glucocil at walmart - Best Vito...
  37. October 31, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i21
    Product similar to glucocil at walmart - Best Vito...
  38. November 10, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i22
    Product similar to glucocil at walmart - Best Vito...
  39. January 10, 2016
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i23
    Product similar to glucocil at walmart - Best Vito...
  40. December 24, 2015

    Comments about this video:

    #capellaproperties #dubai #dubaiuae #dubaiproperties #officespace #officesales #officeforrent #sheikhzayedroad #propertyforsale .

    Product similar to glucocil at walmart - Best Vito...
  41. November 8, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i25
    Product similar to glucocil at walmart - Best Vito...
  42. December 6, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i26
    Product similar to glucocil at walmart - Best Vito...
  43. January 2, 2016
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i27
    Product similar to glucocil at walmart - Best Vito...
  44. October 23, 2015

    Comments about this video:
    +Gary Bussey Safety is our number one priority! In case the Jetmen did encounter wake turbulence, the formation positions for the other aircraft were chosen to ensure the Jetmen had a safe escape route to break clear of the formation and the space required to either regain controlled flight or deploy their parachute. Watch our behind-the-scenes video for more info! :) http://bit.ly/HelloJetmanEK.
    +XDubai Obviously wouldn't be safe, but it would have been so COOL to see them touch the plane while flying!.
    If Emirates wasn't the coolest airline they are now... I mean what airline does something like this. what about oxygen deprivation at those height lack oxygen is common and at that speed it's kinda hard to maintain consciousness and what about gravitational force.
    I have a question, someone please help me with this! Why are we still talking shutup and take my money!.
    +bushpilot223 no but you said i have lots of cool buildings...built from slave labor...i responded...we dont have any cool buildings in canada...not from slave labor not from anyone...because i am in canada. +Kylo Ren well yeah mate the method really does work fine, just tested it myself and did over $400 extra so far already I mean simply go watch this tutorial video here: y2u.be/H8hr6UN9VtA and thank me later on XD.
    Brilliant piece of marketing XDubai. No need to show the super lux cabin, which everyone already knows about just appeal to inner dream of flight. Well done. Anyone know the music or was this an original score.

    The success of any great moral enterprise does not depend upon numbers, go HAM with (I G R O C K E T D O T C O M) and enjoy popularity ON INSTAGRAM.
    Only Reason why i dropped by is to Thumbs Down this footage, i predict this Winged Contraption to be short-lived due to the jet winged/bird-man absurdious concept that does not add up to Match the JB9 jet-Pack Contenders..
    this reminds me of that mission in Advanced Warfare (COD) doesn't it that mission where u fly on jetpack s and cut of the wings of the plane xD.
    Esto es un video de joda! Un boin, para sostenernerce en aire. Precisa una velocidad minima de 210 Kilometros Hora. Con un gasto de combustible de 18 litros por minutos. Los niños que vuela siguiendo la trayectoria de boin. No poseen suficiente combustible para sequir la carera del avion. Ya que el tanque seria demaciado grande para las alas, y comparando con el cuerpo del tripulante...Y otro detalle si vuelan en el muro de empuge de la turbina, Lo desmiembra ya que el empuge de la turbina es de dosmil kilogramos..
    if you want to travel or hajj / umrah, take the plane emirates, most comfortable aircraft in the world, in sha allah amin,,,.

    the refugees can't go there because the security is tight near other gulf countries so their options are to go to Europe.

    Я не знаю это компьютерная графика или наложение на видео, но если бы это было бы в жизни то этих придурков которые вытворяют такие пируэты рядом с натуральным самолетом надо закрыть в тюрьму и на долго так как они подвергают опасности не только свои жизни но и жизни находящихся людей в данном самолете..
    Sometimes they take it from helicopters (I think the fastest it can go is around 250 MPH). But the majority of the time they use a stunt plane.. +bilal dani Who gives a damn man.. look at many of the Asian commercials, they speak English there..
    +jior6 They aren't gliders, they are jet-powered wings. And the A380 was flying very slowly (for an A380) - perhaps 180 knots.
    +James Simmons They had a parachute to land, that's why they had that cut off hole in the wings, they also shut off or slowed down the jet suits first. It would be believable if it LOOKED real, but it does not, so... :-p Cutscenes to the airline pilot cinches the fakeness of this.. they are going pretty fast. in the behind-the-scenes Rossy says that they need to be in an extremely good physical shape to withstand the forces also he mentions they can only do around 10 mins at a time.
    I been looking at all of you guys comments below, I am a local citizen of United Arab Emirates (UAE) and i have no idea whether you guys been to UAE or not. I suggest you search more about my country before making any sort of judgment about it. Like a person who have never heard of a place called (Mexico), i'd search about it and know what's good and what's bad about it. Thanks for passing by though :).

    Coe down amigo. I didnt mean to hurt you or anything, it was only an example ive used. Dont get me wrong porvabor :).

    They're humans, not to mention flying, in what the 13th - 19th century would consider witch craft, and the 0th - 20th century said was impossible, oh also around a giant expensive as heck aircraft, over one of the richest cities on Earth. What have you done with your life, these guys invented and did stunts in a jetpack..
    so what what is the point of this ad urging ppl to buy a jetmanOR SAYING JETMAN IS FASTER THAN THE AIRLINER.
    +Mor Ch it's Add for Dubai - hottest, sexiest, techiest, coolest place on the planet & Emirates airlines of course, billionaires playground - if I could.
    Что это блять за ебанутая реклама дубаев Я никогда не поверю что какая то хуйня так летает на 10 тысячах метров Это что за топливо там у него должно быть Пиздешь.. Why didn't they touch the airplane Even just on the tip of the wings. Would've been awesome if they could have. :). افا الطيران الاماراتي والفديو طالع من اعلى الفديوات مشاهده في السعوديه والاجانب مستحلين الكومنتات بحق احتلوووووووووووووووووووووووووووووووو الكومنتات يامعشر العرب.

    Product similar to glucocil at walmart - Best Vito...
  45. December 14, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i29
    Product similar to glucocil at walmart - Best Vito...
  46. November 20, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i30
    Product similar to glucocil at walmart - Best Vito...
  47. November 12, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i31
    Product similar to glucocil at walmart - Best Vito...
  48. October 19, 2015

    Comments about this video:

    Victor I like your video. I agree 100% Sales Representative for Freightliner Trucks in South Florida.
    from last two months i m getting rejecte in an interview den i thot changing my field but aftr watching dis video i got totally charged up. Thanks a lot victor also you can share some tips to help me 2 pillpopin.aj2 gmail.com.
    2 Del Ata - this video gives you the right mindset. Now, watch my series, "How To Sell"...that's a great second step. Best of luck!.
    i am the top sales man in my company soon to be sales manager, and here's what I did, I hope this helps someone, I learned from the best, I tried everything, I found a way to deal with all objections, I never thought to myself whether in that perticular day it was crouded or not, I had self confidence, I would be really certain of myself, i provide insight.. 2 dotaboy888 I'm not evading the question, I simply don't know how to explain why it sounds different; sorry :-).
    Sales Excellence: How to Become the Greatest Salesperson in the World! The ultimate sales manifesto!.
    Victor, I work for Samsung Telecommunications and I was wanting to use a few of these video's at a store function market meeting, would that be alright Should I contact you via email.
    Just watched it in my office before calling a customer...we've been going through a rough patch. But this was a good morale booster...thanks Victor.
    Thanks Vidtor This is very helpful will be using your video on our Annual Sales Meeting. Thanks man God Bless!. Hehe umm actually my brothers and I go to car lots just to look at the cool vehicles and the Car salesmen thinks he's gonna buy something but he never does lol. So yeah people do go in stores without the intention of buying things..
    That's the best of all i watch in terms of sales... sir can you help me how to convince a customer to buy my chocolates.. Thanks for reply...

    You Sir, are a very practiced salesman. I can respect it, but it frightens me on an intuitive level. That said, there is some interesting information here. Thanks for the video!.
    It was positive with a bit of indecipherable humor tossed in! I'm not a salesman, but I was curious and being able to sell oneself is a useful trait. So in shorter words...You're welcome!. Thank you for the Video. May we see.more Videos about negotiation and bargaining in sales. Thanks .
    This video is much appreciated. I like how you went about in informing us the techniques needed to be a successful salesperson. I'm hoping on pursuing a career in sales when I'm older, and I believe this video to have helped. Thanks again. :) ~Reed~.
    Victor, Thanks for great information you provide, that was very encouraging to me who wants to start new career as a salesperson. Is there any other important advise for a beginner as a salesperson you can provide. I want to share with people in my circles that I just got taught a very valuable lesson! My success or failure is MY responsibility. No excuses anymore..
    Good video, but I actually disagree with the order of importance ever so slightly... The difference between showing and selling is that "showing is throwing information out and hoping it sticks, while "selling" is making it "connectable".. the one thing that is not covered here, happens to be the MOST important! HOW do you know what connectable is, if you haven't asked the questions first The MORE time in "Discovery" the less time in "Close".. one of the truest most foundational facts in selling! AND, in discovery you ASK questions, you do NOT sell value! That's the presentation phase. Don't blur or blend those two together. Be VERY disciplined about their separation. And one last thing... Once a SALESMAN always a SALESMAN!! What that means is this... If you start by "selling" you cannot jump to consultant. So, if you start of by trying to push them using selling puns and quota about product service without fully understanding your customer's genuine needs, then you are "judged" as someone who is just trying to sell. From that moment forward in a client's mind, you are "selling" even when you may be offering him the best advice, he'll just hear it as selling. BECOME a consultant by asking ALL the questions until you are absolutely sure you know what the client wants. STAY a consultant by simply informing him what he needs and WHY... If you jump back into selling, all your previous efforts as a consultant turn into "selling" by default....

    +Chris Banzet Yes, yes Chris, that's exactly how I took it. I enjoy good feedback and well thought out challenges to my assumption(s). That's what good learning is all about and your points were dead on. All my best to you in 2016!.
    +Victor Antonio (Sales Motivation Channel) You as well sir! There's only one thing faster than the speed of light, and that is the change we should make between "teacher" and "student"... :) I learn so much from the GREAT people out there like yourself.. That's why I had to subscribe to your YouTube channel. I sincerely look forward to learning my friend... :) Many Blessings for you as well sir in 2016!. I'm working with the right people who are training me so well so I can be a better salesman but your videos are perfect for my knowledge and my improvements.. Really needed to watch this! So many helpful things that are so useful to know. Thank-you so much for posting this! Brilliant . Byy the way the reason i cannot receive a territory is because we have sales reps already accountable for them.
    You sir, are brilliant. I can sell and was just having a self doubt time and I couldn't perform. After watching this, I am invigorated and hungry again to get my self back up to my ranking I should be. Thank you .
    Hey victor! Good vids man! I am a 14 yr old aspiring to become an entrepreneur. My aim is to estabilish a business empire which provides all types of purely entertainment products and services at a very low cost, at the same time increasing the fame. I would like to know about what all talents I should develop and abt selecting the right team to work with. How do I find the right salespeople, leaders, etc of my age Pls reply in the form of vids or mail. Pls let me know if there are anything else I should look up to or any suggestions. My email id is gurusilky22 gmail.com Thanks G.Guru kalyan Fortitude. and here i was demotivated with 3 months in a sales job!. thanks. i'm really pumped right now!. just a quick question ( i know its a little silly but...) how do you tackle a downward market hope i can get a piece of your wisdom. cheers..
    +Abhishek Dhoundiyal Even in a downward market, people/businesses still buy. Find what they want in a downward market. VA.
    sales manager is not in the shop if your customer want to Return of goods what you will do tell me plz coz tomorrow i have to interv. Sell everyone in it. Do you have any advice on how to tackle a big job on my own with no set territory. you have a weird way of saying information like "informaaation" why is that because you dont talk like that in other videos :) just wondering. they been coming after me for years Taxman Repoman Bankmanger the list goes on lol Just Kidding I have been Headhunted By many a Company Problem was Most Bosses did not even like me Only my Unique Sales Skills so I now am My Own Boss working from home But True I Learnt Many yrs ago if you can Sell & Door Knock Especially on Commision Only You will Always have a Job Most are too Afraid they need that Safety net of a Wage those jobs can go Over night & take you Months 2 replace Commision = start new one Next day, You Set Income Most =Uncapped . i looked at a couple of your videos and i love them, i can t wait to go to work and try everything i learned today,thanks. You're an inspiration too people that want to become salesmen like myself i know you will get famous for just that/ a fan from the begining.
    Wow. just started my first call center job and this will help alot, what i really take from this is the "Insight" very powerful keyword that i will implement from now on. Thank you sir!.

    Not only a good sales person but I can tell ur the man and a man with great skill and good heart... More power to ur channel..

    Mr.Victor Antonio Greetings of the day!! I really impressed by your video firstly I would like to say thanks a lot.and I am Velpula Sudhakar Studied MBA, working in Marketing & Sales Since more then 3years I enjoyed this job in starting days now I am feeling abashed but now really changed my opinion I'll continues with my job now I feel proud to be sale person. today am not sales person I am business person I feel my self as business unit my self. Once again I would say to you thanks a lot and Congratulations - With Regards: Velpula Sudhakar M: #77 99227171 Wats app No. # 8686800654.

    WOW! Amazing. Victor, I'm gonna have interview next week and i thought that your tips on how to attain Sales Excellence really gave me ideas on how to impress the interviewer next week. I want to give you a million thumbs up for your channel. Great Job Victor..
    Haha Best Buy! I just switched departments at Best Buy to Cameras and Gaming and this really helped me to understand. I have that personality to make people feel comfortable and feel like it isn't about the sale. Problem being is I find I give people too much information about different products and they leave to think instead of buy. Thank you for the help, I look forward to watching more!.
    +alan kurtz Giving people information is great if it leads them towards making a more informed decision. Try this, before giving out too much info, ask them to clarify what they're looking for, why they need, how are they going to use it, etc. Knowing these things in advanced will help you "focus the information" you give them THAT GUIDES THEM to a buy decision. Best of luck and keep me posted on your progress. VA.
    You Rock Star! I will be watching all your videos.. Can't wait to learn more from you :) Thanks a lot for sharing.
    I just found difficulty on closing and customer always got all the info and turn back said "consider" /"come back to you shortly". It was so depressed when their face show"i wanna buy". but end up... they still walk out from the door. please advise. What should I to improve. I'm real estate agent. thanks Victor..
    +Victor Antonio Thanks and appreciate your reply, Victor. Yea, totally agreed what you had mentioned above. I'll think about it. It's really confuse to catch the word of trust/credibility (other than improve and find the insight info).. +dianni Tai I have a series on Credibility...watch it and let me know if that helps. Thank you Dianni!. great help! today's my first day as a salesman. although is just selling toys in a small market but i treat it serious and search for the skills that i can use on youtube. luckily I saw this video and now i know what's the basic principle in the sales and what i will need to do to train myself. Thank you so much Victor, I hope one day i can sell myself as good as you did. Great video, great presentation. appreciate it! thanks a lot!.
    +SHI LIN Thank you so much for the great feedback Shi Lin! Best of luck; I'm sure you'll do well! VA.

    Hi Victor, Thank You for your vids and books. I did put into practice some of your techniques and ques what, IT WORKED. I am into cold calling and the biggest drawback is the gatekeeper. How can I get past him/ her Most of the time they simply ask me to email my offers so they can show it to the decision maker. I cannot find a proper way to get the decision maker on the phone. Any advice Thank you .

    DS, that's a tough one. As you know the easiest most effective way to get in is through a referral they know and trust. If you don't have that, then you're competing against every other salesperson calling. Think about how much you hate getting marketing calls and you'll understand how they feel. You need to find a way to get them interested. One of my favorite strategies is the 3 phone VM. Have the gatekeeper put you into VoiceMail and leave a compelling message (one that talks about how you can help them save money or increase revenue). If no response, wait a period and do it again, this time leaving a new compelling VM. Do it the 3rd time and if you get know response, it may be time to move on. Referral or "Planned VM Persistence" are my two suggestions..

    I really appreciate the promise you make in this video about never having to worry about having a job again! Motivating!.
    I'm a business and Virtual Enterprises teacher in a high school in Indonesia but I set up 2 discontinued businesses in my 20s and never really lost my love for selling. Why cant I get sales out of my head ha ha. Great... even one of the best!! Hey looking for a silver bullet sales technique, And correct find it here..
    Dear Victor, what do you think about tire kickers do they exist or is there existence justified by the lousy salesperson.

    Product similar to glucocil at walmart - Best Vito...
  49. January 15, 2016
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i33
    Product similar to glucocil at walmart - Best Vito...
  50. December 29, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i34
    Product similar to glucocil at walmart - Best Vito...
  51. December 26, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i35
    Product similar to glucocil at walmart - Best Vito...
  52. November 17, 2015

    Comments about this video:

    Product similar to glucocil at walmart - Best Vito...
  53. December 28, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i37
    Product similar to glucocil at walmart - Best Vito...
  54. December 9, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i38
    Product similar to glucocil at walmart - Best Vito...
  55. October 22, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i39
    Product similar to glucocil at walmart - Best Vito...
  56. December 21, 2015

    Comments about this video:

    I thought this video was supposed to be about magnesium, I feel like im getting set up for a sales pitch. Is that Sammy Hagar Lol.
    I have all of them in my shelf :) Well the marine phyto is in liquid form in ma fridge :D All these superfoods changed my life beyond imagination. Man im getting excited just thinking about trying these foods. Man you really know your stuff thats admirable man! .

    Product similar to glucocil at walmart - Best Vito...
  57. November 3, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i41
    Product similar to glucocil at walmart - Best Vito...
  58. October 26, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i42
    Product similar to glucocil at walmart - Best Vito...
  59. November 2, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i43
    Product similar to glucocil at walmart - Best Vito...
  60. January 5, 2016

    Comments about this video:

    +cincpac1c Thanks. I actually noticed earlier yesterday, but since he hasn't removed it I have now put in a copyright claim against him. It will be removed imminently. I hope your own video gets protected in the same way..

    I dunno. If I paid 15k ( I don't know what currency it is) I would feel a bit ripped off. Still seemed as boring as any other flight so i guess you can't change that. Did seem to me the runways are a lot longer there as he took his time taking off..
    +clara hutapea Oh yes, I have noticed the poor weather most of the time in Hong Kong, especially early afternoons..
    There must be some little improvement since the video runs slow. Hope your other videos be the best in the future! And thanks for sharing your wonderful experience with Singapore Airlines. Best Regards Joshua .

    Sweet. I went to first class once, and I felt like a god. I can imagine this. Oh and thanks for that. Great quality and thanks for taking time off to share this with us..

    How does it feel to live a life that you travel in such a manner Congrads on whatever profession you are in.. I pray I can one day travel like this!!! Thank you for posting this!!!!!.

    +Shannon Hendricks OK, YES I AM PRAYING FOR YOU, HOPE IN THIS LAST ONE YEAR ALREADY YOU FLOWN IN A380...WISH U GOOD LUCK.
    Please STOP filming out the damn window. We all know what that looks like. You need to film more on the seats, the amenities and the cabin.. Great video!! Invite you to watch the flight experiences of a Brazilian Traveler on our channel. Regards from Rio, Carioca NoMundo. +darklink07uk No, I'm afraid not. It would be good to take them home, they look pretty amazing.. How nice of you to film it the whole way through! I took SQ in R Class twice, SIN-HKG. On both times I was enjoying it so much I only remembered take a few bad pictures! Singapore Air is truly the best. I am way too outgoing to enjoy this. To me a big part of travelling is meeting new people and not sitting in an empty room eating by myself or sitting in an airplane happy about some little appetisers. But if you enjoy this, good on ya, the airline certainly does :). +Nein Danke :-) Glad to have some friendly talk. We are just expressing our opinion. I love premium class for the privacy it offers besides all the perks of lounge access, gourmet food and wine, more personalized service and what not. Also no need to bother the people sitting next to me when I need to go to the loo if I happened to be at the centre or window seat. Errr...I admit it...it only because my company pays for it. On my personal trips, I will fly premium class only if I have sufficient frequent flyer air miles to redeem or upgrade. Otherwise, it will be coach class (horrors...:-P) of budget airlines...hahaha.
    +Nein Danke I love your attitude. Don't change, no matter what the naysayers say we have a shortage of sociable people in today's world and we need more people like you to make it a better place.

    I have flown Singapore Airlines in every class. There is not so much difference between the worst and the best with them. After all it costs them nothing to make you wish that your flight would never land..
    Thanx for report! The First Class seat is similar to Ethad, I flew with Eithad First Class too, and is really cool! The experience was so fantastic, perfect chef in flight, a big Poltrona Frau and i have dedicated to them a nice video too. Have a look if u want, you are welcome!. Ticket price is too high to bear it, they must bring it to reasonable so that instead of going empty and let something come out to increase the profit of airlines.. If you are taking me into a world I have never been before. Please tell me where I am or I will not even get to the plane. ~#confused.
    +Jim Garner It is just one of SQ's flagship routes, so they use the high density A380 on I think 2 of their daily flights..
    +Jim Garner its like they use 747's i think from Hong Kong to Japan or HK to Beijing; they call it the GOlden ROute because it makes so much money as so many people travel it.
    Hi, just interested in what movies they were avalible for selection as I may be flying SQ in the future..
    I think country airlines have to change, Gone are the days where first class counted now first class or business class for short distance cost so much so people think why the hell I spent so much for 2 to 3 hours journey, after getting down at airport I can spend that money in the city which will give more pleasure than what airlines gives.. You know that call of fasten you seatbelts,,, Wass really late lmaoo,, How bout if i was up the plane landed 10 seconds later when she said fasten your seatbelts!! I LOVE THE A380!!!!.
    o a;ways flike like this... im not a spoiled kid or something, my parents work for a Air company and they can upgrade me or them in business class.
    fkn planes. dumpin hundreds of tons of lead and other exhaust chemicals on everyone each year. and crashing or being shot down. failed legacy systems. build bullet trains to do it all cheaper and cleaner. +John Dennis Thankfully, the Bering Strait is much closer. But even that, politics will get prevent that from happening..
    I just love the seatings...lol it's like riding a train luxury at it's best! thanks for uploading I'l be flying this soon!.
    +جوال Zak then do not drink otherwise u will fly high..hehehe.. u dont hv to get scared..this is life cycle everyone has to go one day...just chill..life is too short..don't think about dying.. That's what you get with US $22.000/- plus. In some countries you could buy a new home with that money. . My boss paid for me first class from Singapore to London, I felt like a king! All I needed to finish the job was a BJ :-) and not from my boss.
    I was wondering if you could wank uninterrupted in those booths. Good way to pass a few of those hours. No happy ending though Fuck that for twelve grand..

    I am flying from MEL-SIN on Sunday Evening, landing in Singapore at midnight, then fly from SIN-PHK after a 6 hour layover, and even though I am not going on an A380 or going to those lounges, it is still really very nice to see the luxurious side of changi airport, a excellent video .
    Not sure what you're offering as a first class experience...which is ok too... However, making it feel like a coach on a train I think is rather much... I do agree that more spacious bathrooms are needed...and more bathrooms are needed on airplanes...specially if they do lay overs...and the carpets must be steamed clean...ASAP. I think you need more Lazyboy experiences...for long travel.... it looks great for some1 who wants to take the plane down he can do what ever the fuck he wants without getting saw. Darn. That was too short! Also, for the benefit of those of us who are blind, could you please describe the suite It sounds like you had it all to yourself. Doesn't it get lonely traveling like that Also, it would be so nice if you could give the flight specs: how high & fast you were going, the duration of the flight, food served, oh and what was going on during that noise earlier These ears are just dying to know! My Guide Dog would be so spoiled..
    It is very good but NOT as good as Emirates first class suite. That is why Emirates is the #1 airline in 2013 and Singapore is #3. Qatar is #2. No United States carrier on the top 20 list. I am NOT surprised. The first class of United Airline is NOT as good as the business class of Emirates. .
    I really want to experience Qatar Airways first class. They are an amazing airline even in economy, although I doubt I will like them better than SQ!. mautu ioapo comeform new singapore airline a380 first class suites hd experience thonk you comefrom by mautu ioapo goodday 22.2.2014 youtube videos in my loapotop compter thonk you mautu ioapo comeform . Lee, can u take the Malaysia Airlines a380 first class in the futureHope u can.I guarantee that u will have a great flight but I can't tell that it is better than SIA or EK and he others but it will be great if u can.Thanks!. A symphony of self-indulgence. It's very nice of you to let the lowly peasants see how the other half live.
    +Lee Claxton Not just the noise from the world below, but the noise from the engines and the noise from coach class passengers!.
    +Nightwatchman247365 Plus you don't need to jump over or bother someone sitting next to you when you need to go to the loo. And did I mention less or no queue for the loo :-). Wow more than 655k views already! Did yiutube paid you alreadyHeard that they do that after the first 1k views..
    There is a lot improvements in todays modern aircraft compared to the old ones, they are far more quiet, the disturbance you get from turbulence is absorbed in the softer wings and not transferred to the fuselage. It is difficult to say who is best, it depends on crews attitude, food, service and of course sleeping comfort onboard. I like the A 380, but also the 787, and the 777 -300 ER W models. I have around 100 international and 30 domestic flight a year worldwide and have tried most of the major airlines, but to find a favorite is difficult, it is easier to find a favorite aircraft..
    +Ole Kristoffersen Thank You for your time and soon answer. I´ll see forward. Have a nice day..

    Product similar to glucocil at walmart - Best Vito...
  61. November 27, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i45
    Product similar to glucocil at walmart - Best Vito...
  62. January 20, 2016
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i46
    Product similar to glucocil at walmart - Best Vito...
  63. November 29, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i47
    Product similar to glucocil at walmart - Best Vito...
  64. December 12, 2015

    Comments about this video:
    Typical American comment My jeep can do that Typical idiot comment My land cruiser can do that Typical cheapskate comment Imagine the repair cost Typical hypnotized idiot comment It won't be reliable. +Wagner Wain What is a wheelboard I only knew skate boards and they have been in invented in Germany during the early 1940´s. Some guys in the Wehrmacht thought of using it as a ultra light transport vehicle for foot soldiers, but the roads at that time have not been paved enaugh, esp. in Russia. Even a German newsreal from 1942 shows the Goebels kids playing with this one as there was no military use for it. watchv=JrP2Qd0SETE. The BBC always makes me proud to be British. I mean, no one else can film in such a glorious way. Always were beautiful at presentation and always went the extra 100 miles to be better :).
    +pzkw108 What a terrible fate having you to think about me like that. Guess I'll have to live with that from now on..

    Because the Tanks were build by Porsche. Would have been intresting with the 6 x 6 Version 1943 from Mercedes (hihihi).

    out here temps hit 50c >> bitch please at my backdoor it hits 56c easy in the summer and sometimes even more >>.
    I love these big silly vehicles on the English version of Top Gear. Maybe they can do one on a jet powered pickup. yes, they're out there.. Dude, I agree that arabs are not as clever as you, but they aren't that dumb either! A gigantic willy Seriously!!!.
    the only thing that could be more insane than this is a convertible 6x6 GLE 63S AMG. Come on Merc, i know you want to make one!.
    +Henry Rahardja The max version is actually sold by Brabus with a engine upgrade to 700 bhp an dtey are selling this version as hell. watchv=0ox3zVhsnig.
    I'll be honest, if I won the lottery for one million dollars, and this costing half that, I would definitely buy it and just live in a medium cheap house with a garage big enough to hold this..
    Jeremy is not driving in the dangerous scenes ;and we can see tyre tracks ahead of him ,driven by your 4WD stunt double to guide you where to drive in the lame scenes. I want one. How much MPG ... blew it, if I asked about the MPG obviously I can't afford it. Still how much. Wait.. a 30 40 30 split I'm an idiot but how does the mid-back wheels having more power mean it handles better why not 40 30 30. Mercedes gave gotten better with that issue. That was a Chrysler era issue, before that mercy were always number 1 in reliability. Since losing Chrysler they have gotten allot better..

    Product similar to glucocil at walmart - Best Vito...
  65. November 19, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i49
    Product similar to glucocil at walmart - Best Vito...
  66. November 23, 2015
    People come into your life for a reason, a season or a lifetime. When you know which one it is, you will know what to do for that person. When someone is in your life... i50
    Product similar to glucocil at walmart - Best Vito...
  67. January 9, 2016
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i51
    Product similar to glucocil at walmart - Best Vito...
  68. November 7, 2015

    Comments about this video:

    funniest thing about this muzzies, is when they go to monaco in their huge mega yacht, the women follow in a slightly smaller yacht like a floating harem..

    +Fly Agaric Where the money goes,the quality poon will follow.And you won't see any old on the west middle aged slags on the mini - yacht. Quality poon is a commodity for the wealthy.Only for sale,never to be trusted or loved. That is a rich man's lifestyle..
    Dubai is this dubai is that blah blah. You people are full ov shit You wont give refuge to our brothers and sisters suffering. They are on your doorstep but you still refuse to help them shame on you people. Thers no diffrence between you and me our graves will be the same size i dont think your lambo or your rolex will be coming or your money.
    Sometimes I remember a quote from Forrest Gump: "You only need so much money, the rest is just for showing off." Then I see images of some of the craziness in Dubai and I think its more like "You only need so much money, the rest is just for being a douche bag.".

    +Daniel Ryan you are right. funny how muslims seem desperate to defend consumerism. such hypocritical double douche bags. they are worse than the douches with the money..

    +Daniel Ryan you cant survive without money on this planet owned by stupid people who sell everything to us even our lives !!!!!.

    Lol.. The amount of jealousy in these comments from Caucasian on the westers is laughable. You idiots just can't deal with the fact that these "sand niggers" as you so love to call them are living better than you and found a way to make everyone in their country wealthy. You're all nothing but a bunch of sore losers. They're laughing at all of you..

    +dccmaj man Yeah totally laughing at us. Then you have the rest of the billionaires who live in better countries doing the exact same shit as the "sand niggers" who landed on oil. Guess who's really laughing bud. Have fun living under Islamic Law and getting fucked in the ass for shits and gigs. Fuck off..

    Ermm college is annoying and stressing me, can a Dubai Prince come through and be my sugar daddy please lol xxxxxx.

    There is a reason why Dubai can build these extremely complex infrastructure projects besides oil. Slave labor allows them to build these projects extremely cheaply. For example, the Burj Khalifa cost $1.5 billion, however the Freedom Tower in NYC cost $3.9 billion because of labor costs in the U.S (which in comparison to other developed countries is not that bad)..
    funny it will be when electric cars take over. lol. dubai and all them dirty wasabi muzzies will go back to riding camels, as they should do..
    +CheetaInsaaf fuck dubai, and fuck all muslim cunts. i don't want anything to do them scum. you neither, you fucking dirty camel shagging mug..

    I had forgotten why I disliked Piers Morgan so much, but thanks for reminding me why. And you can keep Dubai, it's not a safe place for single women, and it's rules and regulations are not transparent at all..

    +Maggie Jones Shutup you hag you are mistaking this for Saudi Arabia, I have been to Dubai plenty of times and have seen single rich ladies having fun in the night life, it is one of the great tourist destinations. Don't be jealous you couldn't afford a vacation there.
    These people beat foreign workers from places like India and treat them like animals, im not impressed by this. And when you've lived in the United States this extravaganza becomes ho hum. And what's the point of the buildings being so high when Dubai is surrounded by absolutely nothing. This defeats the point of the view. Perhaps the better to see DAASH coming I guess..
    +children of the light No, but i am lighter skinned than you. Sand nigger is just a insult for your racist comments against Indians and Pakistanis. .

    who wants to see this shit. The Emiraties can't even look after their workers. I don't know why you put this shit on youtube. Its disgusting. Go on flunt your wealth. You can't take it with you when you die..

    CAN YOU MAKE YOUR OWN LAWS ON THE FIFTY MILLION DOLLAR ISLANDS IF SO I WANT ONE..PERFECT PLACE TO GET AWAY FROM WHITE PEOPLE..
    Dubai is place which a safe and Business and Living as a King :) :) :) I LOVE DUBAI !!!!!. i don't understand people want to visit or live there! to live under islamic law is worst than prison. Rich people do stupid things with there money. Dubaii sucks. check here wy. ://igg.me/at/yksmartphonejeans/x/5823580.
    Only Abdilwali Bilal A powerful Lowe world biggaest brid celebrate world sevening 👌 burj Khalifa A let.

    The guys that water all that money on sand are probably kicking themselves now. That whole thing went belly up..
    I absolutely despise the way that the British in Dubai, or wherever they happen to be, are known as 'ex-pats'. They are not...THEY ARE IMMIGRANTS! Say it as it is!. +Esoteric Ed Just guessing since I haven't been there. 9 people that have been to Vegas have watched this video..
    He really is the most monumental c**t of an interviewer. He clearly wants to be the Alan Whicker of his generation. Alas he has none of Whicker's wit, charm or class..
    Just read, it will make sense. OK so it started as a lame sand place, they of course didn't like that so the worked hard and hard... until they found oil, and if they just sat around doing nothing they wouldn't even be rich... The oil made them bigger, better and stronger, now it's and huge rich place, while those homeless just sit around not even thinking to work hard enough to be successful. The harder you work the better your life will be. ☺ It makes more sense, so please stop hating at us muslims. It would mean a lot if you did. I'm not gonna lie and say I wasn't curious about living wealthy in Dubai lol. I'm not jealous at all. In fact, I'm motivated lol I need a mentor or something because I would love to visit..
    The only thing I don't like about Dubai is that it relies on tourism and Abu Dhabi to keep it going. When Abu Dhabi runs out of money, tourism won't be enough to keep Dubai alive. Watch, when Abu Dhabi runs out of oil, Dubai won't last..
    Why the fuck do u care This is the second time I see u moaning about UAE, go fix ur own country fuck Islam fuck Qatar fuxk the Muslim brotherhood.
    befor u look at this video...i live in dubai next to burj khalefa and i proof its bullshiit...why becuse i live here and am from here.
    All the jealous idiots don't realize Dubai started with desert USA didn't and Dubai didn't rob unlike USA robbed middle east countries to get rich.
    «أَنْ تَلِدَ الْأَمَةُ رَبَّتَهَا، وَأَنْ تَرَى الْحُفَاةَ الْعُرَاةَ الْعَالَةَ رِعَاءَ الشَّاءِ يَتَطَاوَلُونَ فِي الْبُنْيَانِ».
    CNN...talk about weather, fashion, cars, sports, health, religion, and...create a war. who owns this media very powerful media. anything on CNN is true for Americans. Rising sea waters will wipe out this American built city for the retards with oil money and they are depleting their oil reserves and will be tossed back to the stone age where they belong along with their barbaric relgion. and Pierce Morgan sucks stinky hairy arab dick..
    +Danger Edm Omfg...Hahaha Now I'm usually not one to defend an English man, but remember who has thousands of troops in in Africa right now too...Yep you've got it...The good old USA. I don't deny that the pedophile ridden halls of Westminster has done some of the despicable things in history, but Washington and her allies, Westminster being one of them are all involved in some of the worst human rights violations today, Iraq, Afghanistan, Palestine (Aiding and assisting Israeli occupation), so your right about Westminster, but America needs a reality check of the biggest kind. And people wonder why my country, Scotland has tried to break ties. I have to admit though, you're comments made me LOLZ... And like I said to my British mate, try and remember, we're NOT all the same on that Island, and have different rules and are governed by a different set of ethics...We even have our own language and everything :).

    Dubai: plastic, soul-lacking, ostentatious, anti-gay, overrated, far away, racist, religious, burning hot, overpriced, built by modern slaves..
    Wow! It`s really extraordinary! Rich Brits able to live in Dubai despite strict laws from the Government so they do really need to learn the laws before going there.. this country seems amazing and mix business with pleasure u have the perfect combination.. :) what surprise me Is that gold cell phone worth 30,000. ponds. I wonder what is that in USA money.
    The majority of people butthurt about the level prosperity probably have never left their own country. Dubai is an almost surreal place, just amazing .

    Piers Morgan: The Luxury Life of Dubai & A Luxury Tour Of Dubai please like https://www.facebook.com/Slim-Life-631888366946998.

    this country seems amazing and mix business with pleasure u have the perfect combination.. :) what surprise me Is that gold cell phone worth 30,000. ponds. I wonder what is that in USA money.
    these hypocrites have took the rights of our prophet (as) and of his family (as), soon they will loose all their luxuries by the calamity that will befall them for their oppressions and tyrannical regime..
    By Investors Abroad: Very interesting video. Find more videos and pictures of Dubai here: https://www.facebook.com/investmentsabroad.
    Built on the backs of slaves. "Dubai is – nothing is what it seems," Karen says. "Nothing. This isn't a city, it's a con-job. They lure you in telling you it's one thing – a modern kind of place – but beneath the surface it's a medieval dictatorship." One woman formerly from Canada. "The Dark Side of Dubai".
    +children of the light You have a lot of time on your hands your spend probably 10% of your life just talking shit to random people on youtube. LOL go get a life, or actually don't, youtube is doing the world a favor by keeping you indoors..

    You're fine as long as you are among the rich Europeans which Arabs secretly adore. But if you are poor, it's the same old Islamic shit hole. Wait till they rape you and you need 4 men to prove it was rape. Everything looks so ugly and fake btw..

    I respect anyone that went from poor to rich. I don't respect those who are born into a rich family. Not a choice but fuck you..
    Too bad alcohol and naked women are illegal there. Might have been a nice place. If you watch the first half of this please do your research first and don't end up being an indentured servant..
    Dubai, built by slave labor. No thanks. It will be rubble as far as the eye can see when the oil runs out..
    +אליה xoxo dubai has no oil its just a small city, abudhabi does ,and no honey there is no country powered by wind & water only....

    Product similar to glucocil at walmart - Best Vito...
  69. December 2, 2015
    Popular Movies. Star Wars: The Force Awakens (2015) The Revenant (2015) Spectre (2015) Mad Max: Fury Road (2015) The Martian (2015) Jurassic World (2015) i53
    Product similar to glucocil at walmart - Best Vito...
  70. November 13, 2015

    Comments about this video:

    Product similar to glucocil at walmart - Best Vito...
  71. December 19, 2015

    Comments about this video:

    I like how in this video they don't show the ugly concrete mess that Kyoto has become. They also don't show the massive crowds at all the touristy places. Enjoy your trip!.
    Amazing Places & Superb picturisation. What more you need to make you fall in love with a place like this. Every places are simply extra ordinary. I bet Kamogawa river will look more beautiful in evenings with lights and off course blossomed trees on its both sides. Nicely done and great choice of music for this. If only I had the money and time to visit soon. Some day though!. Kyoto was one of my favorite place in Japan. Its atmosphear is really particular, romantic, historical, peaceful, beautiful places. Wonderful rememberings ! If I get opportunity to live in Japan, I will certainly choose Kyoto..
    Kyoto is always in my mind. What is the music at the background It is so beautiful. Could you tell me, please I miss kyoto everytime i listen to this.

    What an incredible effort Peter. You have worked very hard and i enjoyed this film. Thank you for letting me be a part of it. Well done to everyone else who was in it. I especially liked the unseen features. Mandy said "ill have to do that one again".
    I wonder what camera is used to shoot the movie, also what camera is the girl holding in the movie :). Japan caused so much misery for us Aussies, I was born in 51 so I learnt from my elders, as a young child growing up I was educated to hate anything Japanese or German, this was a long time ago and its all over, I really enjoy talking with people from other cultures, we live we love we learn.
    Amazing scenery, and might I say, an excellent choice with the beautiful actress. I hope to make the trip some day and hopefully make Kyoto my home..

    +Austin Kaisler Thank you Austin, the actress will be very happy to hear that :) We hope you dream comes true :).
    +Discover Kyoto I would like to soon make a trip to see Kyoto. My Daughter in Law, is a Japanese girl and she is in Tokyo at the moment visiting her mother. I will see Kyoto, I must see Kyoto. Thanks.. I'm going to Japan in late March and will be in Kyoto around march 20th. What are my chances of seeing a few cherry blossom trees starting to bloom It's my absolute dream to see them in bloom but I couldn't go any later... I might be too early :( .
    +Sara Golshani Hi Sara, since the weather has been a bit abnormal this year, it's hard to predict when the blossoming season will be. Usually information about the blossoming season is released in February. If you follow us on Facebook 'Kyoto Fan', we'll share some Sakura inforamtion on there as well..
    +Gisela Natashia Thank you for your feedback!! Hope you can see the beautiful sakura trees in Kyoto one day..
    +TheAliveordead Thank you!! Come to Kyoto! There are a lot of vegetarian food options in Kyoto. There are a couple of us on the team who are vegetarian :).
    Just returned from Kyoto yesterday. I guess everybody has the same reaction as the girl on the video. Kyoto is postcard perfect!. I've only been to Japan when I was a toddler (during a flight layover, from Manila to Philadelphia). Someday, I'll travel there, preferably with a travel club or something. I love it!.
    so gorgeous i can 't even explain wenouh..sweict/switch. after first correct word. Wprd. wprd/ wprd/ word word to ya mom.. il' alawa s. d.e.lf +dlight2020.
    I will use this video as a guide line for my future trip. Kyoto looks so beautiful. Thank you for sharing.. +Samuel Rodriguez You're very welcome and thank you so much for watching our video. Kyoto will be waiting for you.. Great video! Waiting on platform 34 and looking at pictures is something many tourists have prolly done. We shared this video on Forever Kyoto as well!.
    +Forever Kyoto Thank you for sharing the video!!! And yes platform 34 is a great place to view your memories from Kyoto ;).

    Wow... I fell in love with your channel!!! Your videos are so beautiful, they give me goosebumps... Thank you very much for posting them!.
    +Elena De Owwww that's very lovely to hear. Thank you and thank you for being a part of the Discover Kyoto community :).
    What a beautiful commercial! Very artistic! =D N E 1 who knows more commercials like this please reply me with some linx =).
    +Deathrape2001 We're very happy to hear you liked our video!!! You can check out our autumn Kyoto video as well :) https://www.youtube.com/watchv=pV_YXad978k.
    I just returned from Kyoto a week ago and I already miss it! This is a great channel thank you for posting the video.

    Product similar to glucocil at walmart - Best Vito...
  72. November 4, 2015

    Comments about this video:

    ¿Sabías que ese mismo jugador Diab, murió a la semana siguiente de hacer este raro gol Busquen si no me creen..

    que paz decanse Theyab Awana el jugador que cobro el penal y que este con Diosito gozando en el paraiso.
    uhh que bajon que descanze en paz, y gracias por la info. no como los bosteros que hablan estupideces. La mafia mato a Diab, le han de haber pagado.por perder pero metio un gol inesperado y le costo la vida Es una teoria..
    el arquero mas muerto que la reputisima madre xdxdxdxedddddddddddddddddddddddddddxdxxdxdxxdXDXDXDXDXDXDXDDDDXDXDDDDDXXXXDDDDDDDXXXDDD.

    Esta muy raro ese penalti www.pou.me #Pou Logro Desbloqueado: Riega las plantas 50 veces ^_^ 2 PouAlien.
    lo único que entendí del comentarista fue aghsgdj kjaskldjlashdaslkdja kajsdkasdkasjdlkajskdjak hfklajdkjadj ajdkj asdla.
    Alajdldpenmfjfofpfddd alaaa flfodksnenffldl alaalaaaalaaaavfpdkqneldsalsnd lxdodpspwpwpepeodfofld alaaaa.

    eiiiguaalll eiiiguallll rariigaaaaaa kjidjaidjijdieaji mierda... pobresito creo q tiene la lengua larga.. =(.
    alguien me podria decir que significa cuando el comentarista dijo: " no tiene nada que no haya visto antes", gracias. Gurrraj gurraj gurrej al wajij wajaj wajej wajej waje Gurrej majijj al arrij majij malejj al gurrij marij rajejjj. +trovador023 metio ese gran golazo antes de morir,asi que dejalo por que le quedaba una semana :'(. Idioma originak shezjbenflooooooll snebauwbe sbebaheb gebdusbebdi lool snwwndue:Español y biene el jugador va y goooooooll no se si tomo algo antes del partido pero goooll tubo suerte xD. lo q decían todo el tiempo:mahalahatihasalamanricondehalahalíii tohasaempollehtre,traduido en español:vaya golazo por dios,ese tio esta drogado. es verdad decían eso xDDDD yo se árabe.
    Despues del partido" el marika"...osea el patiador le dio el culo otra vez al arkero, pero esta vez sin calzones jajaja.
    me encanto la parte que dice jsijwigwiodjfiofujtgiutjodikcmdofdikjeijifjkifrkjiergkjioskfiejfirjgi ji casi me hace llorar xD.

    Product similar to glucocil at walmart - Best Vito...
  73. November 22, 2015

    Comments about this video:

    +Ahmed Burj It is a simple self-made case mounted to my body wear. It is not the kind of plastic case that you'd expect and can buy online. It you wish I can send you some photos of it. Just drop me a msg with your email address. - Have a great day..
    I've never seen such a thing, stunning airport! I'm from Jeddah so our airport is crap. Let's just hope the new Jeddah airport is better.. Wow, That's sounds amazing. As of now it seems far in the future, but you will see 2020 will approach very quickly. 2035, just typing it, it makes you feel it is still a long way to go. - Thank s for this useful information.. Hamad airport is definitely my second favourite airport (we know which one is my first:))- and those flight attendants on Emirates are so diligent, aren't they.
    +Natasha Stojsic I definitely know which airport is your favorite one. I agree, the Emirates flight attendants do really a great job. Day in, day out. I want to use this opportunity to give them a big praise for all of their efforts. They also have got a big team spirit which seals them together. I asked the crew members and most of the time when they board a plane they meet new colleagues which they haven't met before. Considering this fact it is amazing how well the service aboard their aircraft works..

    I like the architecture of DOH - Even if it is a little bit dark. Is there a difference between sitting in an A330-200, a B777 and an A380 I am looking forward to your next video!.
    +Frederick König Doha airport is definitely much darker compared to Dubai. The comfort in the A330 is not really that nice. B777 and A380 are much better. - Have a great day!.
    Nice new sign(the icon of your site).Btw good video once again good to watch your video! Duty free really good and the best! Hope it's cheaper merchandises!.
    I landed on qatar airways once ! i'm so glad that it won the best airport in middle east this year ! its indeed a 5 stars airport ! its just sooooo BIG !! Dubai airport looked tacky to me after experiencing new Qatar airport lol ! thanks for sharing thi video with us :). +Jazz jazz Yep, Doha airport really earns its place in history. It is a fantastic airport and counts to one of my favorite ones together with Dubai. Both have their distinctive features and are very much different. I personally like the diversity. - Thanks for sharing your experience with us. Have a great day.. +LDMineplex DOH airport has quite a remarkable size and I'd agree that it is bigger than OSL. OSL airport is from what I've seen last time getting an extension or maybe even a new terminal. DOH airport I remember as having only little natural light and a few large flashy displays after security checkpoint. Both airports are very nice and have their own distinctive flair.. +Muzzamil Hussain Right now I have nothing in the pipe as I am currently not traveling so much any more. As soon as I have one I will post it..
    +Jan Wahab Ahmed Thanks for commenting and great to hear that the video helps a lot. - Have a great day..

    Hi UL360! Another great video! This terminal looks huge! It reminds me a little bit of LAX Tom Bradley Intl. Terminal. .
    +thythyli Thanks for the feedback. That's an interesting comparison! I don't know LAX airport at all, never been there. The only thing I hear when talking to others is that everybody say it is big. Have a great day..

    Product similar to glucocil at walmart - Best Vito...
  74. October 28, 2015

    Comments about this video:

    My Friend.. you could have at least reshot 1:02 to 1:05. those kicks in the sand looked really wimpy :p.. yaaoou check me out..

    Of love fill the world You will have Heaven is my father gave me It, you will have Saint message Son, the exact contents of the message within the movie saw my Nibiru UFO videos, check on the link below to sites that can.

    Product similar to glucocil at walmart - Best Vito...
  75. November 28, 2015

    Comments about this video:

    Watch Trailer Movie And Download Fast And Furious 7 2015 Movie Here https://plus.google.com/117671092002719688600/posts/gmxA3boM8QR.
    Watch full movie ==> https://docs.google.com/forms/d/12I3cYWayyIKrd4RFZwvleJn4lpegod_YBUbuBKN9dwo/viewformusp=send_form.
    Since Lucas Black is coming back as Sean Boswell, I hope Bow Wow (Twinkie) & Nathalie Kelley (Neela) also return for Fast & Furious 7. .
    +Mr Django Yeahh those guys really need to make a comeback. And I would like to see more tuners like skyline and rx7 cause they are a legend compared to the cars portrayed in newer films.. Sorry to disappoint they made ether made cameos or they cut the scenes from Tokyo drift to put in furious seven. And Lucas black was only their briefly.
    2:00 dat superman punch tho :D get it anyone roman reigns no bruh... wwe superstar roman regns finisher is superman punch and dat woman does it in deh moovie. now do you get it no FFS this BS!!! :DDD.
    Owen shaw is still alive...his brother said "I'm here for the crew who CRIPPLED my brother " meaning Owen shaw is still alive...p.s. I haven't seen the movie yet so I could be wrong .
    +ZombieSlasher75...did you fucking watch the movie...I did...he is alive..I confirmed that and so will the rest of the world who watched it.
    เสี่ยเจียง แมร่ง! คนไทยอยากดุความภาคภูมิใจของคนไทยด้วยกัน..เสี่ยอ่าฟ้องเหอะจริงๆๆ หนังออกค่อยฟ้องได้ป่ะ.
    +ı ąɱ ą ʂῳɛɖɛ a prime minister of australia. jkd.he is Japanom Yeerum (Thai: จาพนม ยีรัมย์),formerly Tatchakorn Yeerum (Thai: ทัชชกร ยีรัมย์; rtgs: Thatchakon Yiram) or Phanom Yeerum (Thai: พนม ยีรัมย์; rtgs: Phanom Yiram; [pʰanom jiːram]; born February 5, 1976), better known internationally as Tony Jaa, in Thailand as Jaa Phanom (Thai: จา พนม; rtgs: Cha Phanom), is a Thai martial artist, physical educator, actor, action choreographer, film producer, stuntman, director, and has spent time as a Buddhist monk. His films include Ong-Bak: Muay Thai Warrior, Tom-Yum-Goong (also called Warrior King or The Protector), Ong-Bak 2: The Beginning, Ong Bak 3 and Tom Yum Goong 2 (or The Protector 2). go google now.

    im sorry but michelle rodriguez against rhonda rousey is just as believable and michelle againts gina carano...if not less so this franchise has become a laughing stock .
    +xsammyx101x its not michelle rodriguez vs Ronda Rousey. Its 2 Movie Characters vs each other. Are you retarded or something Have you never watched a movie before. Djimon Hounsou: "Who are you" Vin Diesel: "I'm Dominic Torreto!" Djimon Hounsou: "Who". +Melva ArndtHey guys, you can watch full movie right here: https://plus.google.com/u/0/117139841900781174162/posts/S3QCF9MSTKS Enjoy! ;). Some good characters! Cant wait to go see it next week... anyone know who is doing scenes for paul his brother As hes not in this video 😕.
    Hey everyone! please share! I dont ask for much but it wold be awesome if we could get this video out there. Lets make this go viral for Paul https://www.facebook.com/video.phpv=10204726590898039&set=vb.1034838491&type=2&theater.

    I really really really hope then make more movie I hope then make fast and the forious 8 I really hope I really love everyone who in fast and the forious all the movie I seeing I are the best .
    ดีใจค่ะที่1เมษายน นี้ จะได้ดูฟาสต์7แล้ว ศาลแพ่งยกเลิกคำสั่งค่ะ ถือว่าเป็นการละเมิดสิทธิ์ และให้ฉายได้ตามกำหนดเดิม. Everyone is here for Tony Jaa because he's the best action star in cinema to date, if this movie was only about him no one would be upset. . All of these actors are just bringing nothing but fighting and shooting fuck that I want more racing :( .
    Race wars r just a part of it. All the FF ( except Tokyo drift ) are about grand heists. If it is just about racing it would hv gone straight to home video. im a big fan of the series and yes Ive seen all the FF. The FF 7 also includes a race war in it, it can't b just about street racing. If u want a street racing go check out some straight to dvd movies there're plenty of that..
    paul walker would have wanted them to continue making these movies, im sure of it why wouldnt he, i think they all would want that.
    Am I the only one who can't recognize Tony Jaa as Tony Jaa in this movie He looks so different! .

    I just wish I just would be in the movie in fast and the forious I really hope to meet everyone I really everyone .

    ไม่ขอเป็นกำลังใจให้เพราะไม่ได้ไปดู เกลียดมากเลยคะ ทำไมเด็กเเล้วทำไม ทำไมอายุต่ำกว่า15ปีเเล้วทำไม เด็กเเล้วใครตายคะ.
    watch the film I'm not hating on the movie this is just my opinion to be honest i was expecting more i am disappointed there is no reality check at all cars flying,cars crashing and no one end up getting hurt there is no story to the film just one guy trying to get a revenge is just a chasing game only good thing about the movie is the end...
    Aaaaaaaand STILL NO FUCKING WORD OR OICTURE IR VIDEO WITH LUCKAS BLA aka sean boswell I mean LIKE WTF I think they kill him in fast and furious 7 i dont know put shieet i liked that character so much and they DONT PROMOTE HIM AT ALL. .

    Djimon Hounsou: "Who are you" Vin Diesel: "I am Groot." Djimon Hounsou: "Who".
    These movies just keep getting better and better i remember when people thought it was just gangs and street racers saying yo yo yo dog and crap.

    Product similar to glucocil at walmart - Best Vito...
  76. January 6, 2016

    Comments about this video:

    Product similar to glucocil at walmart - Best Vito...
  77. December 13, 2015

    Comments about this video:

    Product similar to glucocil at walmart - Best Vito...
  78. December 16, 2015

    Comments about this video:

    Product similar to glucocil at walmart - Best Vito...
  79. January 12, 2016

    Comments about this video:
    Holy crap, that looks nothing like a McDonalds in the U.S.A. I sure hope their menu is better than ours. While watching this, I was reminded of the movie Demolition Man, when Stallone was invited to Taco Bell for dinner they told him that all restaurants are now Taco Bell. This is Russia's version. :-) Anyway, that's a nice looking place. You Russians better not make a habit of going to those kind of places or you'll end up looking like us. ;-).
    First of all, I rarely eat at Mickey D's or McDonald's as you know it. But that McDonald's is the biggest McDonald's I've ever seen. I never seen any McDonald's that big in the US. Kudos to you for having it! Be careful not to over indulge though!!!.

    It says this: https://www.google.com/webhpsourceid=chrome-instant&ion=1&espv=2&ie=UTF-8#q=is%20moscow%20in%20europe%20or%20asia.
    Hope to visit moscow one day it looks a beautiful place to visit. i know ill get very drunk there on vodka maybe even locked up in a cell, chance ill happily take... McDonalds :') The meat has hardly any meat in it lmao, does anyone even know what's in that If you leave a hamburger or fries somewhere and than you just leave it there for a few months it will look almost the same... it's like idk... hardly food. +Ivan Tsjernov Yes we know. It's cheap garbage full of soy protein and probably more chemical compounds than methamphetamine and cocaine hydrochloride combined. It's poisonous junk food that just might kill you faster than 'meth or cocaine. But man it sure is tasty! :) We've all gotta die sometime!.
    Não gosto do Mc Donald's, mas gostei do vídeo que vocês fizeram. Abraços fraternos do Brasil..
    I went with a group in high school in 92 to Moscow. when we got there we were so jet lagged, two of the teachers left to go to mcd's, which was very close to the hostel we were staying at. they came back with apple pie, small fries, and double cheeseburgers. we were startled at the amount of onions on the burgers compared to US, but pretty tasty. worst part was sun setting around 3 am and rising again around 6 am. total sleep deprivation after 2 weeks. beautiful country. wonderful people..
    Heard this McD's closed last year, 2014. Still, 1990-2014 is a long time. They close in America too, and re-open somewhere else! They opened a new one about 5 miles from my house, the drive thru is always full! I eat there a couple times a month, and it's always good..

    +ranscott2005 http://www.ibtimes.co.uk/mcdonalds-biggest-russian-restaurant-reopens-pushkin-square-1475604.
    Is it expensive to buy a turkey in Russia A friend of mine would always freeze a couple turkeys to take back home to the mother land. My friend said a good turkey is hard to find and expensive in Russia..
    For a long time it was necessary to close the McDonald's across the country of Russia. Products sold to McDonalds cause cancer and diabetes, especially increased the rate in children. In America, every year the percentage zabolevschih diabetes. For those who belongs to McDonald's, they zaineresovany that make people ill and spent more free money for medical treatment, onkalogiyu.

    holy crap that is a big mc donalds lol, i live in Puerto Rico (an island) and there isnt anything like that in here, not even close lol. Is like a city in there lol.
    Thinking about moving to Russia! Great way to learn about culture there! Thank you, +Real Russia for the videos!. Very interesting to see this, I ate there in 2002 just to see if it was like in the US. Beware, the food may taste good but is not so healthy for you. Don't go there very often or you will get fat!. +Andy Krone I can't explain it, but I really like that kind of food, even more than exclusive dishes in luxurious restaurans!) Yep, we know it is unhealthy, but...)).
    It's as huge as a mall, and it's astounding to me that it's full of people. For some reason I would think that russians wouldn't care much about it. I guess it's a globalized world..

    Didn't see the bacteria ridden play area where Your Kids can be pestered by others and come home with any sort of disease! This series is Great, Thank You Guys, We in the U.S. have been raised to believe Russia is some sort of 'backward Country' that is supposed to be some sort of threat..I am seeing here, Y'all are just People - trying to get by in this crazy World - like the rest of us! Rock On Real Russia. Big Mac, Vannila Shake and Hot Cherry Pie x 2 Please. To Go!.

    ISN'T THIS ONE ,ONE THE CLOSED MACDONALD IN MOSCOW IF IT'S A FACT, I'M LOVING IT. AND SO RUSSIAN HEALTH SYSTEM.
    Im from the UK and McDonalds is not something I would normally eat. I now live in Moscow and it is the best food you can buy here. The food in general is horrible. . +Patrick O'Neil Dude I am American and I visit Russia every year and I can tell you that there is plenty of good food. I love the stuffed cabbages, the pelmeni, the piroshkies the Chicken Kiev and all the wonderful pancakes you get in Russia. You are nuts.. This first Mac in the USSR (!) was opened in 1988, not in 1990. I was among those 'happy' moscovite citizens who got into it having stood over a great line (appr. 500 m). It was amazing time when the Russians were being aquainted with American stuffs. I remember an american guy standing in front of me. He had withstood all the time in the line and when I asked him what was the reason for such a heroic deed he answered (smth like that): I missed American meal (!). The smell around the restorant was really magnificient. BTW the Big Mac costed about 1.30 $ US. And one more detail. There was a big Canadian Flag in the entrance (). All the employees were able to communicate in English and, moreover, all the managers were an englishspeaking personnel. They often shouted in English: Trays!! The interior was absolutly another - much more interesting and exquisite. Being their was really cool! It was the strongest propaganda of the on the west lifestyle, 'intoxicating smell of capitalism'..
    I havent been to Russia but have been to China so I can imagine when i see the episode about Russian apartments what its like to live there I think, there are some similarities for sure. It would have been great to know what the american guy thought of the taste the taste is different in every country thats for sure. interesting reading your comment, Hi from australia...

    OK, nice comment. But I nevertheless haven't understood your attitude to McDonalds or your ideas about FastFood intervention to the Eastern world. I have to note that these days (I mean sanctions on Russians) McDonalds has became a sense of politics. Many people refused visiting these restaurants. Just some 26 years and how many changes, isn't it.
    I have eaten there a few times but mainly I get fries and a large coffee black.I did hear that they were building another Papa johns, but when in Russia when not on business I try to eat local cuisine.
    The food is less salty and greasy than here in the U.S. I was surprised that they charged extra money for ketchup (as much as you want for free here), which also tasted different than the ketchup here (still Heinz). There was also an absence of obese people in the McDonalds. Great video..
    reason there are no fat people at Macds is that food is so expensive when you live in Moscow that you can almost not afford it. +Paul Black what McDonalds is the cheapest fast food caffe in Moscow, even when I was a pupil I could spend cash money on fast food in stead of school canteen!). Russia's 3 main capital cities, Moscow, Sankt Petersburg and Kazan are in European Russia. Tesla Boy has become a permanent earworm. Thank you so much, I'm going to be singing that song one of these days, and no one will know it but me.. Привет! Great vid man:) I am learning russian so I will make sure I go to russia In the future:) greetings from UK . The biggest Mcdonalds now is in London, England it's in the middle of the Olympic park and it was opened in 2012, and the second biggest Mcdonalds is the one you're showing us in Moscow. I could not believe how long the line was the first day the first Mcdonalds in Russia opened in Moscow, from what i seen in your previous video it must of been at least 2-3 miles long, the people at the end of the line probably waited at least 12-20 hours to get their burger.. I live near a Kroger's grocery store(a big US chain) that is the biggest Kroger's in America! So I understand your thrill to be visiting the biggest McDonalds in Europe.. Wanna know why we don't have a big McDonalds in America Because in some towns you have 2, 3 or even 4 McDonalds restaurants. .
    +AKraised It was in 90th, coz people didn't have anything like this! Now it shares the popularity with similar fast food caffes and restaurans. And, yep, people just like that food, several even prefere it to dishes in restaurans).
    In Norway we pay 1,69 dollars for a double cheeseburger, about 15 dollars for a menu and you have to ask the staff for a code to open the toilet door :-) .
    +TheMargeBliss In Russia a lot of people come to McD to the toilet =) As it is always free and usually clean =) 1.69 $ - we have the same prises (bm a little bit lower), here McD is supposed to be the cheapest caffes).

    hi in the USA you only have to borrow a key to the bathroom in a bad neighborhood. most places not locked and has several stalls too.

    Everybody eats McDonalds at some point. However, why is it so busy in Russia It's pretty shit food methinks haha.
    Open more mcdonalds in russia actually the russian govermeant can buy the entire courperstion McDonalds.. Security chased me out of there for taking pictures at the entrance of Reagan and Gorbachev! They have a photo gallery of the history of the establishment at the entrance. The cafe is basically separate and more upscale. Great video!!!!!.
    You should know that workers are exploited in those places and the food is junk or made with generic crap..
    Or 199090 :O Just kidding we know it isn't your first language and it was an honest mistake. Still you speak VERY GOOD! ;).
    Why would someone that values their health eat in McDonald's Not a chance I would be seen dead there..
    XD Ich lebe auch noch in der Realität nur XD ,ehr nicht da die Geister (ja lacht ruhig) In mir wohnen (ja die sind von hinten und von oben in mir reingekrochen) Ich kenne alles XD XD weil ihr alle immer 2 macht XD ausser Japan ;-).

    Product similar to glucocil at walmart - Best Vito...
  80.  (resveratrol ultimas noticias)
     (resveratrol ultima review)
     (cheap resveratrol ultima sale online)
     (resveratrol ultima results)
     (online consultation for resveratrol ultima)
     (uk alternative resveratrol ultima)
     (extra cheap resveratrol ultima)
     (buy resveratrol ultima cheap medication)
     (resveratrol ultima at discount prices)
     (resveratrol ultima caps)
  81. January 28, 2016

    Comments about this video:

    Global Resveratrol Industry 2015 Deep Market Research...
  82. February 4, 2016

    Comments about this video:

    Global Resveratrol Industry 2015 Deep Market Research...
  83. February 11, 2016

    Comments about this video:

    Search - resveratrol - iHerb.com
  84. January 18, 2016

    Comments about this video:

    Resveratrol|trans-Resveratrol|CAS 501-36-0 Buy Resveratrol...
  85. January 23, 2016

    Comments about this video:

    resveratrol | eBay
  86. February 15, 2016

    Comments about this video:

    Purchase resveratrol ultima - Buy Products In Vito Mol...
  87. February 2, 2016

    Comments about this video:

    Ford Explorer for Sale from Owner 200,000 Km 144672 - AUTO...
  88. January 17, 2016

    Comments about this video:

    Resveratrol Supplier (CAS 501-36-0): R&D Systems
  89. Popular pages:
    Resveratrol Ultima Capsule
    Resveratrol Ultima Anti Aging
    Cheapest Resveratrol Ultima Prices
    Will Resveratrol Ultima Give A False Positive Ana Blood Test
    Resveratrol Ultima And Women
    All About Resveratrol Ultima Doubtfully
    Cheap Resveratrol Ultima Line Uae
    Resveratrol Ultima Only
    Resveratrol Ultima Cash On Delivery
    Resveratrol Ultima Suppliers In The Saudi Arabia



  • Hoodia Gordonii Absolute

    Hoodia Gordonii Absolute

    Hoodia Gordonii Absolute works as an appetite suppressant and weight loss.
    More info »

  • NicoNot

    NicoNot

    NicoNot has been helping men fight their withdrawal symptoms and quit gracefully.
    More info »